Identifiers and Description

Gene Model Identifier

Contig18400.0.g81

Standard Name

CAT1c

Aliases

Contig18400_0_g81

Description

Catalase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011460301.0000943968537097e-101catalase family protein
SGDYDR256C7.002185723491005e-79CTA1 SGDID:S000002664, Chr IV
from 969680-968133, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18400.0.g81(coding)
ATGATCCTACTTTCAAATCAAAATCAGGAAAAAAGCTTACTCAACAAGGGACAGACTCAA
AGCCTGCTACACCTCGAGGTCCTATTCGAGAATTCAATGATACTAACTTTTATTCAAGAA
AAAATTGTTGAACGTTCTCTTTTTGCTAAAGGTTCAGGAGCTCACGGGTACTTTGAGCTT
TCTGGAGAAATGAGTTAATTCACTAAAGCTAAATTTCTAAATGGTAAAATAGGAAAATAA
ACTCCATTATTTGTACGATTCTCTCCCTCACTTGTTGGTGAAAGAGGAGTCGCGGATACA
ATAAGAGACATTAAAGGTATGTAAATGAAGTTCTACACTGAGGAGGGTAACTATGATTTA
ATCACAATGAATACACAAGTTTTCTATATCAACGATATGATTAAACTTCCAGATTTGATG
CATGCCATGAGACCTTCACCCTAAGCACATCTATTTGATTCAAATTCTTTTTGGGACTAT
CTCTCTTTAATGCCAGAGTCAATAAATTAAGCGATTTACACTTATGCGCATAACTTCATT
CCTGATGGTTATGAACATATGAATACCTATAGTATAAACACTTACAAATGGCTGAATTCC
AATGGTGAAACTTTCTATGTTAGGTATCATGTCATCAATTCACAAGCTCAAGAGTTCTAT
CTTATCAGTGAATAAGCTTAAGATTTGTATGCACAGCCTGACTTTTATGCAAAAAGATTA
TTTGAATTGATAGAAAATGGTACTTTTCCTGAATGGGAAATAAGTGTATAAATTTTGAAT
GAAAAGGATGCGAATAATTTCAAGTATGATGTTAATGACCCAACAAAAACATGGGATGGT
ATAGCATTAAAAAAGCTCGGGAAAATTGTTTTGAATAAGAACCCAGACAATCACTTTGCA
GAAGTAGAACAAGTGGCCTTCAATCATGGTCATTTCGTAGATGGAATTTAAGCTTCTGAT
GATAAACTTCTTCAAGGTTTTATTTTCTTAGACCAAGATGATACCATTAACAGGCTAGGA
GCAAATTATGATTAAATACCAATAAACCGCCCTTACAGAGCTGGCCCATAAAATAGTTAC
TCAAGAGACGGGGAATATAGTACTCATGGAAACTATGGGCACACAGTTAATTACTATCCT
AATTCTTAAAATGGACCTGTTGACTCAACTAGAGTTCCCGTTACAACAACATTAACATCG
AGTAAAGCTTCCTCATCTAAAGCTGGTGCAGATGATGTAGTTGTAGTTAAAAAGAAATCT
TATGATAATTTTGAGTTGGCAGCTGCGAGATACAAAAATATGCCAAAATACGAAAAGGAT
GTATTGGCTTCAAATCTAACAATTTAATTAAGAAACATTAAATAAGATATTAGAGAAAGA
ATGATAAGCTTGCTTGAAAAGGTAAGCGTTGACTTAGCAGCAAACATCAGAAGTCAAATT
TGA


>Contig18400.0.g81(protein)
MILLSNQNQEKSLLNKGQTQSLLHLEVLFENSMILTFIQEKIVERSLFAKGSGAHGYFEL
SGEMSQFTKAKFLNGKIGKQTPLFVRFSPSLVGERGVADTIRDIKGMQMKFYTEEGNYDL
ITMNTQVFYINDMIKLPDLMHAMRPSPQAHLFDSNSFWDYLSLMPESINQAIYTYAHNFI
PDGYEHMNTYSINTYKWLNSNGETFYVRYHVINSQAQEFYLISEQAQDLYAQPDFYAKRL
FELIENGTFPEWEISVQILNEKDANNFKYDVNDPTKTWDGIALKKLGKIVLNKNPDNHFA
EVEQVAFNHGHFVDGIQASDDKLLQGFIFLDQDDTINRLGANYDQIPINRPYRAGPQNSY
SRDGEYSTHGNYGHTVNYYPNSQNGPVDSTRVPVTTTLTSSKASSSKAGADDVVVVKKKS
YDNFELAAARYKNMPKYEKDVLASNLTIQLRNIKQDIRERMISLLEKVSVDLAANIRSQI