Identifiers and Description

Gene Model Identifier

Contig16632.0.g72

Standard Name

CARS

Aliases

Contig16632_0_g72

Description

tRNA synthetases class I (C) catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01406 ) tRNA synthetases class I (C) catalytic domain
  • ( pfam09334 ) tRNA synthetases class I (M)
  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005600004.001665021984168e-167cysteinyl-tRNA synthetase fami
ly protein
SGDYNL247W3.000551941601253e-121YNL247W SGDID:S000005191, Chr
XIV from 182875-185178, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16632.0.g72(coding)
ATGGAGTTAGTTACTGCGGCGTGCAAGTTGATCTTAACTAAGCATCAACAAACAAAATGG
AAACTACAAAAACAAACGGAACACAATCAGGTACCTTTATTCTAATATTTTAACCATAAA
TTACTTGTAGCAGGTGGAATGCCAAAGCTTCACATCCTCAACTCCTTCACAAGAGAAAAG
GAGCTATTCGTGCCTAGGCATGCCGATAAAAACGTAGTGACTTGGTACATGTGCGGACCT
ACAGTCTATGTCGACTCACATATGGGCCATGCCAGGACCTATTTGAGTTCAGATATCATT
AAGAGAATCATGAGAGATTTCTTTGGCTATGATGTTAAGATGTGCATGAACATTACTGAT
GTCGATGACAAGATTATTAAGAGATCATTTGAGTAAGGAGAACCATTCGGTGAATTCAGC
AGAAGATTTGAGACAGATTTCTTCAATGATATGAAAGCACTTAATGTCGAGTTACCTGAT
GTCATTACAAGAGTATCAGAGTTCGTGCCAGAAATCGTCAAATTTATTGAGAAAATTATT
GAAAATGGCTTTGCTTACGAGTCAAATGGCTCAGTATACTTTGATGTAAAGAAATTCAAC
GATCATGAGAATCACACTTATGCAAAATTAGAACCCACTTCAGTAGGCAATGAAGACAGT
ATGAAAGAAAGTGAGGGTGTCTTGACCAATCACGAAACAGTTGATAAGAAAGGCAAGCAA
GACTTCGCACTATGGAAGAAATCTAAGCCAGATGAACCTGTCTGGAATTCTCCCTGGGGT
GAGGGCAGACCTGGATGGCACATTGAGTGCTCTGCTATGGCTTCAGAGTTCTTCAAAGAG
TTCCCTATTGATATTCACTCTGGTGGTATCGATCTTAGATTCCCTCATCATGATAATGAA
ATTGCTCAATCTGAGGCTTATTACAACTGCGATAACTGGATCAACTATTTTATTCACACC
GGTCATCTTCATATTGAAGGAAGAAAGATGGCAAGATCACTGAAAAACTTTACTACCATC
AAAGATGTTCTCGGTGTTTACAGCGCTAGATAAATCAGAATATTGTTCCTTTTACACAAC
TGGGAAAATTTGATGAACTACTCAACTGAAAAATCCATGCCAGAAGCTGTTGAGAAAGAA
AGAAGATTCCACGAGTTCTTCTTGAACGTTAAAGCTTTCTTAAGACAGTGCGATGTTTAG
TCAACTGAACAAAAATGGAACCCCAGAGACTACGAGCTTGATGCTATTCTTTCACAAAAG
ACATTCTTGATCTATGAAAGACTAGCTGATAACTTTGATACTCCAAGCGTTATTCACCAC
TTGGATGACTTAATAACTGCAACCAATGCCTATTTACAACAAAACAGCAAACTTATTAAG
ATTCCACTTGTCACTAAAGTAAGCAAGTATATTTTCAAGATACTCAAGACTTTTGGTGTA
TACGAAGAAGATATTAGTCCATCTCTATCTTAAGAATCTCAGCAAGTTAACCTCGAAGAA
GCAATCGCTCCTTATGTTAATGCACTCTCTTAATTCAGAGACACCATCAAGGAAAAAGCT
GAGCTAGGACCAAAAGAAATGTTCAAGATTTGCGATCAATTAAGAGACGACATTTTACCA
AATCTTGGTATTAGATTAGAGGACAGAGGCAAGGGTTAAGTTTCACTCTGGAAATACGAA
GATAAGGAAGTCCTCTTAAAAGAGAAGGAAGCTAAAATTCAAGAAAAACTTAAAAAGGAA
GAGGAGAAGCGTCAAAGAGCTGAGCTTGACCTTAAAAAGAAGTCAACTTCAGCAAAAGAC
TGGTTTAAAGTCATGCAAGGAGAGAAGTACTCAAAGTATGACGATGAGGGTCTACCAACT
CACGACGAGAAGGATAAAGAATTGAGCGAGTCAATTAGAAACAAGCTGAAAAAGGAACAA
AAGAAGTAAGAAGGTGTTTACGAAAAATGGCTTAAGGAGCAACAAGAAAAGCAGCTTGCT
GCTGGTCAAGAGGAATAAAAGGCTTAACAATGA


>Contig16632.0.g72(protein)
MELVTAACKLILTKHQQTKWKLQKQTEHNQVPLFQYFNHKLLVAGGMPKLHILNSFTREK
ELFVPRHADKNVVTWYMCGPTVYVDSHMGHARTYLSSDIIKRIMRDFFGYDVKMCMNITD
VDDKIIKRSFEQGEPFGEFSRRFETDFFNDMKALNVELPDVITRVSEFVPEIVKFIEKII
ENGFAYESNGSVYFDVKKFNDHENHTYAKLEPTSVGNEDSMKESEGVLTNHETVDKKGKQ
DFALWKKSKPDEPVWNSPWGEGRPGWHIECSAMASEFFKEFPIDIHSGGIDLRFPHHDNE
IAQSEAYYNCDNWINYFIHTGHLHIEGRKMARSLKNFTTIKDVLGVYSARQIRILFLLHN
WENLMNYSTEKSMPEAVEKERRFHEFFLNVKAFLRQCDVQSTEQKWNPRDYELDAILSQK
TFLIYERLADNFDTPSVIHHLDDLITATNAYLQQNSKLIKIPLVTKVSKYIFKILKTFGV
YEEDISPSLSQESQQVNLEEAIAPYVNALSQFRDTIKEKAELGPKEMFKICDQLRDDILP
NLGIRLEDRGKGQVSLWKYEDKEVLLKEKEAKIQEKLKKEEEKRQRAELDLKKKSTSAKD
WFKVMQGEKYSKYDDEGLPTHDEKDKELSESIRNKLKKEQKKQEGVYEKWLKEQQEKQLA
AGQEEQKAQQ