Identifiers and Description

Gene Model Identifier

Contig18170.0.g72

Standard Name

CARM1

Aliases

Contig18170_0_g72

Description

Ribosomal protein L11 methyltransferase (PrmA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR034C4.000521932330652e-52HMT1 SGDID:S000000238, Chr II
from 305976-304930, Genom...
T. thermophilaTTHERM_002194906.000481660141652e-51hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18170.0.g72(coding)
ATGGAGTAATCATTACAAGATATTCAAGAAGCTGGACTGCAGTAAAATCCTTCTATGGTA
GGGGGCATCAATACAAATGAAGAATCTAGTGTTCACTAATACTTTAAGTTTTACTCCAAG
TTGCAGAATCAGTAAAATATGCTGATGGATGAGATAAGAACCACTTAATACAGAAATGCT
ATTCTCAACAATCGCATTGACTTTCAAGATAAAATAGTGCTTGATGTGGGAGCTGGTTCA
GGCATATTGTCCTTATTTGCAGCATAAGCTGGTGCGAGAAAAGTTTATGCAATAGAAGCC
TCGAATATGGCAGAGAGTGCAAGAAGATTGATTGATGCAAACGGATATTCTTAAATTATT
GAAGTTATTCAATCTAAAATAGAAGATATTCCAGATGACAGGATCGGCAAAATTGTTGAC
ACAATTGTCAGCGAACCATTAGGAACGTTTTTACTAAACGAAAGAATGCTTGAAACTTAC
GTAATTGCAAGAGAAAAGTTCCTGAAACCTAATGGGAAAATGTTCCCTGCTACTTCTCAT
CTATGCATTATGCCATTTTATGATGAAGCTGTTCATCTTGAACAACAAAATAAGTGCACT
TTTTGGGATAATAAAAATTTCTACGGACTCGATTTAAGTTGCCTAAAAGAAAAGGCCTTG
CAAGAGAAGTTATCGTAACCTTTAATTGATACTTACGATCCTAGAAAAAATTTGTGTGAA
AATCCCGACAGAATGATCTTCGACTTTGAAACTTGTTCACTGCAAGATTTATAAGAGATT
GACTTTTTCTTCAAGCACAGGATGGATAAAACAGGCCTTATTCATGGATATGCTTTGTAT
TTTGATGCGATATTCAAAGGATCTGAGTAATACGTAACACTTTAGACTGGCCCCTTCTCT
CCACCAACTCATTGGTACTAAACTCGTTTACTCCTGAAAGAACCTTTAGGCGTTAACAAG
GGTTAGTTAGTTTAAGGATATCTAAAGATGAGAGCGAATAAAGAGCAAACATTTGATGTT
TCAATCGATGTTCAAATCCCTATTCTTAATATAAACTCTGTAAATACTTTTGATATGAAA
GATCCAGAGTACAGAGGCGTCTACTAAAATTACTATGATCAGTACAACACTACAAATCAA
CAATAAAACTAACAACAATATTACCCATAAGGTAATTAATAAATGCAAAATTAAAGCTCA
AGCTAATGGCAATAGCAGTATGATGGTTTTCCCTAAATATGA


>Contig18170.0.g72(protein)
MEQSLQDIQEAGLQQNPSMVGGINTNEESSVHQYFKFYSKLQNQQNMLMDEIRTTQYRNA
ILNNRIDFQDKIVLDVGAGSGILSLFAAQAGARKVYAIEASNMAESARRLIDANGYSQII
EVIQSKIEDIPDDRIGKIVDTIVSEPLGTFLLNERMLETYVIAREKFLKPNGKMFPATSH
LCIMPFYDEAVHLEQQNKCTFWDNKNFYGLDLSCLKEKALQEKLSQPLIDTYDPRKNLCE
NPDRMIFDFETCSLQDLQEIDFFFKHRMDKTGLIHGYALYFDAIFKGSEQYVTLQTGPFS
PPTHWYQTRLLLKEPLGVNKGQLVQGYLKMRANKEQTFDVSIDVQIPILNINSVNTFDMK
DPEYRGVYQNYYDQYNTTNQQQNQQQYYPQGNQQMQNQSSSQWQQQYDGFPQI