Identifiers and Description

Gene Model Identifier

Contig10134.0.g98

Standard Name

CAPER2

Aliases

Contig10134_0_g98

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11608 ) Limkain b1
  • ( pfam12871 ) Pre-mRNA-splicing factor 38-associated hydrophilic C-term

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001011509.002663577881587e-59splicing factor, CC1-like fami
ly protein
SGDYOL123W0.0000004998288985444982HRP1 SGDID:S000005483, Chr XV
from 87844-89448, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10134.0.g98(coding)
ATGGCAGATCTAGACCTAGATGCTCTTGAAGAGCTAATCAAGCAAGAGGAAAAGGCAAAA
TAAGCTTAAGAATCAGGGAGAGATAGAAGATCCTCCCGCTCTTCAGGCGATGATAGGAGA
AGACCAAGCAAATCAGATTCACGCTCTCACAAGAAGAAATCTCATAAACATAGGAGAAGA
CATAGCAGATCCCGATCATATGAAGGAGACAGGAAGCATAAGAGAAGATCTGGTTCAAGA
AGAAGGGATGATTCTGAAGAGGAAAGACGCAAAAATCGCGATAGAAATGGAAAGGAGGGA
GATCGTGATGGAAAAGAACCAAATGCAGAACCAGAGATTGACCCTGTTAAAAAGCAAGAA
GAAGCACTATTAAAACAAATCGAAGAAGCAAAGAGACAAGCAGAAGAGTCTCAGAGAGAT
GACTGCACAGTCTTGGTTAACAGAATCGCTTTGCATGCGAATGAAAGAGATATGTATAAT
TTCTTCTCTAAAGAAAAGGGTGTCGGAAAGATTAGAGATGTGAGACTTATCCGCGATTAA
AGATCAGGTAAATCAAAAGGGATTGCATATGTAGAATTTTACACACCAGAGTCGGTTCTA
TTGGCTATGGCTCTCTCAGGGACATAGTTTATGGGATAAACAATTATGATTTAGGCATCT
CAAGCTGAGAAGAATAGAGCTGCTGCGGCTTCAAAATACAAGAAGGAGCAAGATAGATTT
GGAAATCTTGGGAATCCTAAACCTCAACCTCAGAAGAAAGTTGATCTTGAGAATCAAGTA
TTCGTAGGAGGACTTATTGATGTTTTGAATCAAGTAAACGAATAAGACATTAGAGGGTGG
TTTACACCATTTGGAGACATCGAGACTATTGAGTTGCCAAAAGATCATATAACTGGCCGT
AACAAGGGCCATGCCATCATTACTTACAGGAAACATAAGTATGCAAGAACTGCAGTAAAA
GAAATGAATGGCTTTGATATCAATGGAAGAAAACTTAAGGTTCAAATTATGACAGAGGCA
AACAGCAAATTGATGAATCAGAGAGGAGCGGGAGACTATGATCTCGAAGATGACTCAGCA
AACTAATATATTCATTCTGCTTAATCTAGAGCTCTGTTGATGTAAAAACTTAGTAGAGAG
TCAAACAAGTAAGATTCTGGTTAATCTATTATGGCCCAAAATTATAACAATCATGCTGCA
GTACAACAGTATGCTCAGGCTATGCCATCAAACTGTGTGCTGCTAAATAACATGTTTGAC
CCTACTGGAGTAGACCTTAAAAAGGACCCAGCATATTTCATCGATGTGAAAGAGCAAGTT
GAGGATGTTTGCAGTGAATTTGGAAAAGTAGAGAAAGTGTGGGTTGAACAAGCAGCTGGT
AATTGTTGGGTAAAGTTCAACAAAAATGATATCCAAGGTGCTTAGAGATCACAAATGACT
CTAAATCAAAGATACTTTGATGGCAGACTAATCACAGCTAATTTCGTACCAGAGAACGTT
TTCTATGGTAAAGTCAAGGAGAGATGA


>Contig10134.0.g98(protein)
MADLDLDALEELIKQEEKAKQAQESGRDRRSSRSSGDDRRRPSKSDSRSHKKKSHKHRRR
HSRSRSYEGDRKHKRRSGSRRRDDSEEERRKNRDRNGKEGDRDGKEPNAEPEIDPVKKQE
EALLKQIEEAKRQAEESQRDDCTVLVNRIALHANERDMYNFFSKEKGVGKIRDVRLIRDQ
RSGKSKGIAYVEFYTPESVLLAMALSGTQFMGQTIMIQASQAEKNRAAAASKYKKEQDRF
GNLGNPKPQPQKKVDLENQVFVGGLIDVLNQVNEQDIRGWFTPFGDIETIELPKDHITGR
NKGHAIITYRKHKYARTAVKEMNGFDINGRKLKVQIMTEANSKLMNQRGAGDYDLEDDSA
NQYIHSAQSRALLMQKLSRESNKQDSGQSIMAQNYNNHAAVQQYAQAMPSNCVLLNNMFD
PTGVDLKKDPAYFIDVKEQVEDVCSEFGKVEKVWVEQAAGNCWVKFNKNDIQGAQRSQMT
LNQRYFDGRLITANFVPENVFYGKVKER