Identifiers and Description

Gene Model Identifier

Contig10134.0.g97

Standard Name

CAPER1

Aliases

Contig10134_0_g97

Description

Rhomboid family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10134.0.g97(coding)
ATGAGTCTCTTCCCCTTCAGATCGAGCACCTTGGTAAAATACTTGCCAATCCACGCTCCC
CGTCAAAACGCAATCAAGTACTTCTTGTACGCTAACACCGGGCTCTTCGCCTACTACCAT
CTTGTGAGCGGTCCTCAGCAATTCATTATGAAGAGAGGTTTTGAAGTGCACAACGAATCA
AACATGCAAAGTGTGCTCAACTATCACCTTGTTAACTTTAGCTTGACCTCACTTCTCTTT
AATGGAGCAATTTTCTATACTATTGGAAACTACCATTTGCAAAAGTTTGGTGGAAATCAT
TTGCTTAGATTATTGGGAGTCTCAGCTCTTGCAGGTTCCCTTGTATCAGCATACTCAATC
AACCAAGATTCTTCTTTCCAAGCTAAAGGAAGCATTTCCTTGTCAGCTGGACTTATCGCT
TACAATGTAATGAAGAATCCTCAATGGTTTAAGTATGCTATTGGTCCCGCAGGTTACCTC
TCACTCTTCGTTCTCTACGGAGCTTTCTATAATGACAGAGCTGCTCTTAGTGGAGTTGGC
GCAGGCTGGTTATTATTCTTAATGGGTCTCTGA


>Contig10134.0.g97(protein)
MSLFPFRSSTLVKYLPIHAPRQNAIKYFLYANTGLFAYYHLVSGPQQFIMKRGFEVHNES
NMQSVLNYHLVNFSLTSLLFNGAIFYTIGNYHLQKFGGNHLLRLLGVSALAGSLVSAYSI
NQDSSFQAKGSISLSAGLIAYNVMKNPQWFKYAIGPAGYLSLFVLYGAFYNDRAALSGVG
AGWLLFLMGL