Identifiers and Description

Gene Model Identifier

Contig5716.0.g10

Standard Name

CAP1c

Aliases

Contig5716_0_g10

Description

Dual specificity phosphatase, catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00782 ) Dual specificity phosphatase, catalytic domain
  • ( pfam13350 ) Tyrosine phosphatase family
  • ( pfam03162 ) Tyrosine phosphatase family
  • ( pfam00102 ) Protein-tyrosine phosphatase

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5716.0.g10(coding)
ATGAAACCATAATTGTTTAGCCACAAAAGTAAGACACCTGGAGACCTTCCTAAATGGCTA
AATACTACACCCTATGGAAAGCCACTGAAACGTGAAATACTGAATAAAAATGGAGAATTA
ATGAAAATTAGAATTGTGCCTTTTAAGACACCCCTATCAAAAGATCTTGACTAATTTATA
CCTGAAGATAAAAGACTACATCCTGATTAATTAATCAAGCACTACTAAGAGTAAAATGTT
TATCTTAAAGGTTAACAGATCCCATACCCATAGTTCCTAAACTTATTCAATTCATACATG
ATTAACTTTGAAAAATAGATGACTTAAGATAATGAATATATTGGGGTGCACTGCACTCAT
GGGAAAAACCGTACTGGTTTGATGATTGTGCAGTATTTATGCAAAGTTAAAAATATTGAA
TTGGATGTTGCTTTTAAGGAATTTAATGAAGCAAGAGCCCCAGAAACATTAGACAAGGAA
ATGTATTTAGAGTATTTGCACGAATAGTTTTCTTATTAGAAAAATATCAATTTTGATGAT
ACTAAAGTTACACTTTGA


>Contig5716.0.g10(protein)
MKPQLFSHKSKTPGDLPKWLNTTPYGKPLKREILNKNGELMKIRIVPFKTPLSKDLDQFI
PEDKRLHPDQLIKHYQEQNVYLKGQQIPYPQFLNLFNSYMINFEKQMTQDNEYIGVHCTH
GKNRTGLMIVQYLCKVKNIELDVAFKEFNEARAPETLDKEMYLEYLHEQFSYQKNINFDD
TKVTL