Identifiers and Description

Gene Model Identifier

Contig1451.1.g15

Standard Name

CAP1a

Aliases

Contig1451_1_g15

Description

mRNA capping enzyme, catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01331 ) mRNA capping enzyme, catalytic domain
  • ( pfam03919 ) mRNA capping enzyme, C-terminal domain
  • ( pfam01068 ) ATP dependent DNA ligase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007602002.000470901975128e-28mRNA capping enzyme, C-termina
l domain contai...
SGDYGL130W9.002093297142233e-23CEG1 SGDID:S000003098, Chr VII
from 266145-267524, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1451.1.g15(coding)
ATGGAGAATCATAATCACAATCATAGCACTCAAAATTCAAGTTTGCCCAAGATTAATCTC
GAAACTTATGGTAAACAGACATCAGTATAGGAATAAGAATTTATTAAAGGTGAATTGAAA
AAGATATTCTCAAAAACAGGTGAAGTATTGCAAAGAGATAAACACATTATCATTGATAAT
GGAGGCTTTGATGAAGAGTTGATAACAAAAGCAATTAAGTCATTTAAACACTTCTGTCCA
TCACACCCAACTTAAAGTAATGGCTCTAACAATTTTCGAAGTCAAACAGATCAATTTCCT
GGTGCTTAGCCAGTTTCTTTCCAACAATCAAATATTTATTAGATACAGCAGCATAAATTC
ATTGTTTGTGAGAAATCTGATGGACTCCGATATTTCCTGATTGAAACTAACAAGAAAGAG
TTTTATATTGTTGATAGGTAATTTAACATTAGAAAGGTTTCGCCACGATATATAGATTTT
AGTTAAACTGCACCATCTGCAATAGTAAACATATTTGATGGAGAGTTAGTGCTCGATAAT
CATTAAAGGGATATACCTATTTTTTTGGTATTTGACGCTATGCTAGTCAATGGCAGATCT
TGCATGTTAGAGAGTTTCACTAATAGGTTGTTAGCTGGACACAATGAAATTAGAAGGAGG
GTTCGATCTGCTTAGGTGTAATTTATGAAAAATTAGGGGAGAAATTAGAATGGTAGAAAC
CTCCCCAAAAACATCGTCGATATCTACATGAAGGACATGTTTAGACTGCAAGATGTAGAG
TATATATTTAACAATATAGTTCCAAAGCTCCAGCATGAAAATGATGGGTTAATTATGACA
TAAGATTTGTGTCCTTACTATCCTGGTACCTGCTAAGAAATATTGAAGTGGAAACCAAGG
CATCTAAACACGATTGATTTCAGATTGAAATTGCTCTCAGCTCATACCCATCAGTCATAC
TTATGGGGACTTTAAACTTGCAGTTACGATAGAATCACTAAAACTAAGTAATTGCACTTA
TTTGACTTTATCTTCTTTGACTATGAAGTAAAAGATTAGAATGGATAAACTGAGAACGAT
CGTATGCGCACCTTGATTTAAAACTCTCCCGATATGGTTTGCATTATAGAGTGCTACTTG
GATGATTAATACGCTCATCCCCACTTAATCATCTTTAACAAGCTAAAGTATGAACTTGAA
AACTCTTCTGTGCTCTCGGAAGAGAACAACCTGGAACAACTTTCCTAAGGCTTTGACTTC
AATATGCGACTTTCTTATGAAGATCGCGAATAATTCAAAGGTGGCTGGCGTTTTCACAGA
CATAGATCAGAAAGAGTAGATCCCAACGCACAAAAAAGTGCGACTAGTGTTTTGGACAGT
ATAAAAAACGGCATAGAAATGCAGGATCTTATACATGTATGCAGCTCAATTCCTAATCTA
GATAATGGACATGGCAATGGAAGAAGGAGACTGAGGTCTTCAGATGGAAACGATGAAGAG
CAGGATAATTAAATAAAATCAAGCAATAAAAAGCAAAAACAGGATGAAGAAGATGAATAT
TGA


>Contig1451.1.g15(protein)
MENHNHNHSTQNSSLPKINLETYGKQTSVQEQEFIKGELKKIFSKTGEVLQRDKHIIIDN
GGFDEELITKAIKSFKHFCPSHPTQSNGSNNFRSQTDQFPGAQPVSFQQSNIYQIQQHKF
IVCEKSDGLRYFLIETNKKEFYIVDRQFNIRKVSPRYIDFSQTAPSAIVNIFDGELVLDN
HQRDIPIFLVFDAMLVNGRSCMLESFTNRLLAGHNEIRRRVRSAQVQFMKNQGRNQNGRN
LPKNIVDIYMKDMFRLQDVEYIFNNIVPKLQHENDGLIMTQDLCPYYPGTCQEILKWKPR
HLNTIDFRLKLLSAHTHQSYLWGLQTCSYDRITKTKQLHLFDFIFFDYEVKDQNGQTEND
RMRTLIQNSPDMVCIIECYLDDQYAHPHLIIFNKLKYELENSSVLSEENNLEQLSQGFDF
NMRLSYEDREQFKGGWRFHRHRSERVDPNAQKSATSVLDSIKNGIEMQDLIHVCSSIPNL
DNGHGNGRRRLRSSDGNDEEQDNQIKSSNKKQKQDEEDEY