Identifiers and Description

Gene Model Identifier

Contig6371.0.g69

Standard Name

CALR

Aliases

Contig6371_0_g69

Description

Calreticulin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6371.0.g69(coding)
ATGCCTTCGAGATCTGATACTGTTATAATGTTTGGAGTATAAATGTGCGGCAGTCATTAG
AAAATCGTAATAGACTTCAATTATGACAAGAAATATCTCACATGGAGAGAGTTTGTTAAG
CCTCCTGAATAATCAATCTTTGAAAATGATTTCAACAATTTGCATTAAATGAGACTGACA
ATTTTCAAAAACAAAACCTATCAATTAGAAATTGATGGTGAAGTAAAATTATAGGATGAT
TTTACAAAAGGCTGGGATTTTATTGGGCCCTCTCATTTAGAAAACCAGTTAGATACCTCA
AACTTTGATTATAAAGTAAAGAGAAGTATGTCATTTATCGATGAAATTTTCTCGCCTAAA
AAGAGAAAAATCGTGACTTTTTCCCTGGTAAACACTTAAACCCTCACATATTCAATGATA
TATAAGGGGTTCAAGTTGTTGTAGAGGAAAACTATTCTTCATTTATGA


>Contig6371.0.g69(protein)
MPSRSDTVIMFGVQMCGSHQKIVIDFNYDKKYLTWREFVKPPEQSIFENDFNNLHQMRLT
IFKNKTYQLEIDGEVKLQDDFTKGWDFIGPSHLENQLDTSNFDYKVKRSMSFIDEIFSPK
KRKIVTFSLVNTQTLTYSMIYKGFKLLQRKTILHL