Identifiers and Description

Gene Model Identifier

Contig12239.0.g71

Standard Name

CAF1a

Aliases

Contig12239_0_g71

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam12265 ) Histone-binding protein RBBP4 or subunit C of CAF1 complex
  • ( pfam12894 ) Anaphase-promoting complex subunit 4 WD40 domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006886601.999382702437002e-145hypothetical protein
SGDYEL056W9.001321650308988e-69HAT2 SGDID:S000000782, Chr V f
rom 47168-48373, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12239.0.g71(coding)
ATGAACGCATTTTAAGATCAAGTTGAAAACACAGACGAGGTTGAGGAGCAAAAGATATTT
GAGGAGTATAAAATATGGAAGAAAAACGCCCCATTTTTCTATGATACACTCTATTCACAT
GCCCTAACCTGGCCCACATTAACTTGTGAATGGATGCCTTCCCGCGATGTGCCTCATGGA
TCAGACTGCTCAGTATAAAAGCTACTGATAGGAACTCACACTTCAAATGATGAGTAGAAC
TATATATAAATCATGAAGGTTAAAATCCCATTAGAATCATCCAAGGATACTCGTGACTAC
CAAGATAACGCTAAAGATGCAACTGGAATTAATGCTAACACCTAGAAAAATGAGAGAATT
TAGATTGAGACTCAAATTAATCATGCTGGAGAAGTTAATAGAGCTCGTTATATGCCTTAA
TCACACAATATCATCGCCACAAAGACTACTAGTGGCGAGGTCCACATTTTTGATTACTTT
AAGCATCCCACAAAGCCAGCTAACGATCAAGTCAAGCCAGATTTGAGATTATAAGGACAT
AAAAAAGAGGGTTTTGGTCTTGCTTGGAACCCAGTGAATGGAGGTATGCTGCTCTCTGGC
TCAGACGATGGTATTATTTGCATCTGGGATGTGAACAAACCCAATTAACTCAATAACACA
ATAGATCCATTGTATACTTTTGAGGCTCATACTCAAGTCGTGGAGGATGTTGCATGGAAT
TGCCATGATGGTAACTTATTCGCTAGTGTCAGTGATGATAAGAGACTTATTCTTTGGGAC
TTGAGAGACAGACAGCCCTCATCCAATATTGAAGCACACATGGCTGAAATTATGTCAGTT
GACTACTCGCCATTTGATCAGAACTTATTGGTCACTGGATCTGCTGATGGTTCAGTTGCT
GTTTGGGACACAAGAAATATCAAGAGTAAACTTTTCTCACTCAGATAGCATAAGGATGAA
GTGACTTAAGTTAAATTCAGTCCAATGCTAGGAAACTTAATTGCATCATCAGGCGCAGAT
CGCAGAGTCATGGTTTGGGACTTATCAAGAATTGACAGACCTCAAACAGAGGAGGAGAAG
AGAGATGGTCCTCCTGAGTTGATGTTTGTGCACGGTGGTATGACTTCCAAGGTTTCAGAT
ATCGCATGGAACTTAAATGAGAAGTTAATGATGGCTTCGTGCTCAGAGGATAACATCCTG
CAAGTCTGGCAAATTGCTCATGAAATCTACTATGATCAGGCATATTGA


>Contig12239.0.g71(protein)
MNAFQDQVENTDEVEEQKIFEEYKIWKKNAPFFYDTLYSHALTWPTLTCEWMPSRDVPHG
SDCSVQKLLIGTHTSNDEQNYIQIMKVKIPLESSKDTRDYQDNAKDATGINANTQKNERI
QIETQINHAGEVNRARYMPQSHNIIATKTTSGEVHIFDYFKHPTKPANDQVKPDLRLQGH
KKEGFGLAWNPVNGGMLLSGSDDGIICIWDVNKPNQLNNTIDPLYTFEAHTQVVEDVAWN
CHDGNLFASVSDDKRLILWDLRDRQPSSNIEAHMAEIMSVDYSPFDQNLLVTGSADGSVA
VWDTRNIKSKLFSLRQHKDEVTQVKFSPMLGNLIASSGADRRVMVWDLSRIDRPQTEEEK
RDGPPELMFVHGGMTSKVSDIAWNLNEKLMMASCSEDNILQVWQIAHEIYYDQAY