Identifiers and Description

Gene Model Identifier

Contig20889.0.g22

Standard Name

CACTIN

Aliases

Contig20889_0_g22

Description

Cactus-binding C-terminus of cactin protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam09732 ) Cactus-binding C-terminus of cactin protein
  • ( pfam10312 ) Conserved mid region of cactin
  • ( pfam08648 ) Protein of unknown function (DUF1777)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004593806.996603630663804e-52hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20889.0.g22(coding)
ATGGAAAGTAGATCTAGAGAGTCTTTAAACTCTGATAGACGCCAAAGAGTAAGAAGTAGA
TCAAGAGACAGAGAGAGGAACAAGACTGAAGATAATAGACCTAGAAATTAAAGGCAAAGA
AGCTAAAGCAAAGGGTCTTCATAAAGTTCAAGTCTCTATAGTAGCAATAGTTCTTAAAAA
TCTGCACAAAATGCCTAAAGTCATCATCAAGCCACATCACAGTGGAAAATTAAGGAGGAG
TAATTTCACCTTGAACAAGCAATTCTAAGATCTAAACTTAGAATATCTAGCAATAGAGAG
AAACCCATTGATTTCTTGGCCAAAGTCATATTGATAGTTACAGATAAGCTACCAGTTTCA
ATAGACTTTCTAAGTGAAGACTATAAATTCTCATATCAAATGATGGAAATCCTTAGTCTT
AAAGACCTTCTAGAGCTAAGAGATGACATACTAGTGTTTTTAAATATTGACAAAAAAAAT
CAAGGATTCCAATCTTATTGGATATCTCAATTAGTTCTCTGTGAAAGCTTACTAGAGAAA
AAGAAGAAAATTTAAGAGTAAAATTTAGACGAACCTATACTTGAGAACGACGACAATAAA
CTTGTATAGAATGAAGAACTAGAAATGGAGGCTGAATCTATGATTGAGGGAAAATCTATA
GATGAGCTCATAGAGTTATAAAAAGAAATTCAGCAGAGTCTTACAATAGACAAGAGTTTT
GCAATGGAAATGTAATACTGGTAAAATTTACTTAAAAGAATCAAAGTGCAATTAGCAAAG
CTTAGAATTGAGAAAATCTACTCTGATTTTGTTAATGATAATAAATTGAAGATTGAAGAT
TAAATCAGAGTTCTAGAAGAATAAAAAGCTTAAGAAAATAAAGATTAAACTAAGCAGAAG
TCGTATAAATAGCCATTTACTTCCTTGACAATCGATAATATCACAAATGTAGCTTCTAGA
ACCTAGCCTGTTTCTCAAGGCTAAAACAATTTATCGATTGATACTTCAACCACAAACAAT
AAATTCTCTTCTGCATATAACGAAGGAGATCTTTCTCCAATTCTAATAAGCTTCGAGGAG
GCAGGATTTTTAAAATCTGTAGCTATAAATGAGTCAGAGGACCAGTAAGATCAAGATATT
CAAAGAAAACAGTACATTCAAAGGAAAATGGAGAAACTTAAATTGTAGGAAGAAAAGAAG
GATGATAATGGCAAACTTCCTCCAGCTGATAAAGTTAAGAAAACTGCTTTGAACACTCTT
GTTAGATTTGATATGGATGCAAAGGGATATGAGACTACTTCTAATGCAATGTATGATGAG
ATTAGAAGAAAAGGGCTAGGAGCTGATGAAGTTGAATTCACAGATATAGTGTCTTAAGAC
TTTGACAATAAAGTGAAATATGATTGGTCAGACAAATTTAAGCCAAGAAAGCCTAAATTC
TTCTGTAGTGTGTTGACAGGATATGAGTGGAATAAATACAACTAGACTCACTATGATGCT
GATAATCCTCCTCCAAAGATTGTTCAGGGCTATAAGTTCAACATCTTCTATCCTGATTTA
ATTGATAAGACCAAAACCCCTAGATTCTTCCTCGAGTCTGACCTCTCTTCAGATACAATT
ACCATAAGATTCCATGCAGGACCACCCTATGAAGATATCGCTTTTAAGATTATCAATAGA
GAGTGGGAAATGTCTGAGAGACATGGATTTAGAAATGTATTTGACAGGGGAGTTCTTCAA
TTGTACTTCAGTTTCAAGAAACATAGATATAGGAGATGA


>Contig20889.0.g22(protein)
MESRSRESLNSDRRQRVRSRSRDRERNKTEDNRPRNQRQRSQSKGSSQSSSLYSSNSSQK
SAQNAQSHHQATSQWKIKEEQFHLEQAILRSKLRISSNREKPIDFLAKVILIVTDKLPVS
IDFLSEDYKFSYQMMEILSLKDLLELRDDILVFLNIDKKNQGFQSYWISQLVLCESLLEK
KKKIQEQNLDEPILENDDNKLVQNEELEMEAESMIEGKSIDELIELQKEIQQSLTIDKSF
AMEMQYWQNLLKRIKVQLAKLRIEKIYSDFVNDNKLKIEDQIRVLEEQKAQENKDQTKQK
SYKQPFTSLTIDNITNVASRTQPVSQGQNNLSIDTSTTNNKFSSAYNEGDLSPILISFEE
AGFLKSVAINESEDQQDQDIQRKQYIQRKMEKLKLQEEKKDDNGKLPPADKVKKTALNTL
VRFDMDAKGYETTSNAMYDEIRRKGLGADEVEFTDIVSQDFDNKVKYDWSDKFKPRKPKF
FCSVLTGYEWNKYNQTHYDADNPPPKIVQGYKFNIFYPDLIDKTKTPRFFLESDLSSDTI
TIRFHAGPPYEDIAFKIINREWEMSERHGFRNVFDRGVLQLYFSFKKHRYRR