Identifiers and Description

Gene Model Identifier

Contig21986.0.g57

Standard Name

C9orf156

Aliases

Contig21986_0_g57

Description

Uncharacterised protein family UPF0066

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01980 ) Uncharacterised protein family UPF0066
  • ( pfam03485 ) Arginyl tRNA synthetase N terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21986.0.g57(coding)
ATGATTGAGTTGCAAACCCAGGGAAAAATCCCTCCCATCTTAAATGCAAGTAAAGCTAAT
ACGCCACGCTCAGCAAGAAAGAAACAAAACAATCAAGGACATGTTATGATTGAAGCAAAT
TGGGAATTTGATGCAAAAGATCATAATTGCGAGAGATATGGAAATTTCAGCACTCACACT
ATCATTAAACTAGTTTCCAAGTATAACAAGTCAACAATTTCAATGAACAATCCAGGTAAC
GCAGAGGAGATTGCTTAAATCATGGCAGATGAACTTAACAAGAAGATTCATGATGAGGAG
GGAAGCGGCAGTGGTTAGTCAGACTAACATAATCAGACACTTATTCATCAGGAAATTGCT
AAGTTCGAGGCCAAATCAGGATTCCTGAATATTTTCTTGGAAAATTCACAGTTTATGGAT
AGAATTCAAATTATGAACAAAAAGAAGACTGTGACATATAAGGAAGGCAACATGTTCAGT
CCAGGACATCAAAATGAAAATCCACTTGAGTCTGCTTTTGTTATTAGACCCATAGGATAT
TTGGAATCATGCTTTAGAGAAAAGTTTGGTACTCCAAGATAGAGTGGATTTGTTAAAAAT
GCTAGAGCTAGGTTAACTCTTGTGAATGAGATAAATAGCAGTTGCTTAGAGGGACTAGAT
GAATTTGGATATATCTGGGTGATCTTCATTTTCCATGTTGGTCTTCACGACTACAACAAT
AAGAAGACCAAGATTGTCCCACCTAAGCTAGAAGGTGCAAAGAAGGGTGTTTTTGCCACA
AGGTCTCCTCATAGATACAACCCAATCGGTTTGTCTATAGCAAAGCTTGAAAAGATTGAA
GACAGAACCATTACGATTTCAGGCATAGATCTGATTCACGGCACTCCAGTTCTCGATATC
AAACCCTACCATTATCTTGACAGTTTGGATAAAGAATAACTTGTATTCCCTAATTGGTTG
GTTGAAAGCAAGGAAAGAGGCAGATTGCATGTTTAATTTACAGAGGAAGCCATAGAAGAG
GTGAAATAGTTGGTTTACTCAGGGAAGTTAGATTTCTATCATTCTTTTGAAGAAGTCAAA
GAACTCATTGAGTAGGTCTTTGAACTCAATCCACACTCTATTCACACTCTCAATAAACAT
AAAGAAGGAATTTATGCAGTAGCACTTGATAACATGAATATTATATACAAGATGAATGAA
GAAAAAACATAGATAACAATAATTTAGGTAATTTGGTCAGATAACACAAAGCCCAAGGAA
AAGTTGCGGACGAAAGAATGGCTGCTAAAAATCAGTGAGTTTATAGATTCAAACTCCACC
CCTCAGACAATCATAAATCATAACAAAAACGACTAAGTAGAAGAGGAGAAGAAGGAATGA


>Contig21986.0.g57(protein)
MIELQTQGKIPPILNASKANTPRSARKKQNNQGHVMIEANWEFDAKDHNCERYGNFSTHT
IIKLVSKYNKSTISMNNPGNAEEIAQIMADELNKKIHDEEGSGSGQSDQHNQTLIHQEIA
KFEAKSGFLNIFLENSQFMDRIQIMNKKKTVTYKEGNMFSPGHQNENPLESAFVIRPIGY
LESCFREKFGTPRQSGFVKNARARLTLVNEINSSCLEGLDEFGYIWVIFIFHVGLHDYNN
KKTKIVPPKLEGAKKGVFATRSPHRYNPIGLSIAKLEKIEDRTITISGIDLIHGTPVLDI
KPYHYLDSLDKEQLVFPNWLVESKERGRLHVQFTEEAIEEVKQLVYSGKLDFYHSFEEVK
ELIEQVFELNPHSIHTLNKHKEGIYAVALDNMNIIYKMNEEKTQITIIQVIWSDNTKPKE
KLRTKEWLLKISEFIDSNSTPQTIINHNKNDQVEEEKKE