Identifiers and Description

Gene Model Identifier

Contig17087.0.g16

Standard Name

C9orf114

Aliases

Contig17087_0_g16

Description

Putative RNA methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02598 ) Putative RNA methyltransferase
  • ( pfam01954 ) Protein of unknown function DUF104
  • ( pfam00588 ) SpoU rRNA Methylase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010161502.0007467515522948e-59Uncharacterized ACR, COG2106 f
amily protein
SGDYMR310C0.0000000000010000211161514907YMR310C SGDID:S000004927, Chr
XIII from 896669-895716, ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17087.0.g16(coding)
ATGAATAAAAGAGATCATTAAATATCAGATAAATCAAAGAAAATCAAGAAAGACAAGAAA
GAAAAGAAGAATAAAGATTAATTAGAAGGAGTGGTGTGTTTCGATGATGATAATGACGAT
TTCGAAGTGGTTTAAAATACTATAGATAATCAAACATAATAAAAGAAAAATAAGTAAAAA
ATCGAAAGCAGTGACGATAGCGATAGCGAAATGGAATATCAGAGGCACTCGTCATAGTTC
AAGAATATATACAAGGAAACTAAGAGAGGCTTCACAATTTCAATAGTGGTACCATCATCA
ATCATAGATAACGCGCAATCCCTAGAGTTGAAAACTTACCTCGTGGGTTAAATAGCAAAG
GCATGTGGGCATTTTGGGGTAAACGAGATTATTGTATATTCTAATGACAGGCAGCAGCAC
ATGAAAAATCTTGTGGGAGATACTCGTACTACCACCACTGAATTCTTCGTTAAAAATTTG
GAGTATATTGAGACACCTTAGTATTTGAGAAAAGCTTTGTTCCCTAGGCATAGTGCTTTA
AGATACACCGGATTGACAAATCCATTGGAAGGTCCCCATCATCTCAAAATTACTGAATGG
TGTGCTTATAGAGAAGGAGTTGTAATTAATAGACCTACAGCACATGGAAAGGGGTCCTGG
GTAAACATTGGACTTCCAAAAGATTGCCAAGTTGACATATAATTAGAAGAAGGTACAAGA
GTGACTGTGAAATTAAACGAGAAGAATTTTGATAATACCAGGTACTACTCAGGAGTAGTG
GTTAGCTCCAATGAACCAACTGAGAAATTAGGCCTCTTTTGGGGTTATACAGTCAGAGTA
GCAAATAAATTCGAGGATATCTTTGATGAATGCCCCTTTGAAGAGACAGGCTACGATTTA
AAGCTTGGAGTGAGCGAACAAGGTTAAGAAATTGAGCACGTAGATTTCAGATAGCATTAG
AATTTCAAGCATGCTCTAATTTTCTTTGGAGGAATGGAAGGCATCGAAGGTATCATTGAA
TAGGATGAGAGAACCAAAATGAGTACAGAAGCAATAAAGAAGAAGTTTGATTCATTAATT
AACCCTGTTCCTGAAAGAGGGACTAGAACTATCAGAACTGAGGAGAGTATTTTAGTTACA
ATGTCTAGTTTATATCCTAAATTAAGAGCAATTGGATTGAAGTTGTGA


>Contig17087.0.g16(protein)
MNKRDHQISDKSKKIKKDKKEKKNKDQLEGVVCFDDDNDDFEVVQNTIDNQTQQKKNKQK
IESSDDSDSEMEYQRHSSQFKNIYKETKRGFTISIVVPSSIIDNAQSLELKTYLVGQIAK
ACGHFGVNEIIVYSNDRQQHMKNLVGDTRTTTTEFFVKNLEYIETPQYLRKALFPRHSAL
RYTGLTNPLEGPHHLKITEWCAYREGVVINRPTAHGKGSWVNIGLPKDCQVDIQLEEGTR
VTVKLNEKNFDNTRYYSGVVVSSNEPTEKLGLFWGYTVRVANKFEDIFDECPFEETGYDL
KLGVSEQGQEIEHVDFRQHQNFKHALIFFGGMEGIEGIIEQDERTKMSTEAIKKKFDSLI
NPVPERGTRTIRTEESILVTMSSLYPKLRAIGLKL