Identifiers and Description

Gene Model Identifier

Contig17080.0.g15

Standard Name

C2HC1b

Aliases

Contig17080_0_g15

Description

zinc-finger of a C2HC-type

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007216606.998542127613979e-20hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17080.0.g15(coding)
ATGTCATAGGCTTAGGAGTGGGCAGAAAAGAAAAAATAACAATTGGAAAAGGCTAAATTA
ATCAAAGAAGAAAGAAAAGCTGCCAGTTAAATAAGGCAATCTATCAAGAGTCAAGCAAAC
GAGGGTGGGAGTGCTGGAAGTGGAGGATTTTCAATGCGACCACAATCTAATCATCAATAA
AATAGATTAGGGTCTGCTTTGCAACAAAAATAAAATACTAGTAGCTACAGTAATTTACCT
TAAAATAATGGAAGGCAGGGAATTAATTCTCAGCAATAATTTCAAAGTGATTATAATAAA
AACAATGGATATGAAATTTAAGGGCATAAACCGCAAATCAGATAAACAGTTGGAGGGGGA
ATTGGCAGTTCTAATTTTAGTAAAATTAGTGGGAATGTGAATACTAATATAGATTTTGGC
TACCTCAATCATCAGTCATAGTCAAACATGAATCAAGATAGTTATAGGAAAGTGATGTAG
CAGTAATAACCTCAAGATAATGCTAGACCACTTTAAAGTAAAGTGTCGTAACAAAAGCCA
ATGTAGAATTATTATTAAGAAGAGTAAAAAGTGTAAAGTAGAATTACAACCAAACCTCCT
GCTATGACTTCTAATAGTAATTTTAACAGACCCTCTTCTGGAATACCTCAATAAAAGATG
TAAAGTAATAACACTGTTTCTAAACGACCACAGAGTGGAGTAAAGAGGCCGGAACTTGGC
TATGCAAGCTAAATGATAAGAAATGATGAATTCAACGATGGATTTTAGGACTAATAACAA
CCTAGAAAGCAAATCTAATAGAAAAAAGTAGTTAGTAAGCCTCCCGCTAGGATGCCACCC
TCTATGGCGTTTTAGCAGCCTAAGGATATGAATCTTAACGAATGCAAAAGTTGTGGAAGA
TCTTTTAATGATGAAGCTTATGCAAAGCACTCAAGAATTTGCAAAAAGGTTTTCTAAACT
AAAAGAAAGGTTTTCAATTCATAAGCCAAAAGAATTATTAGTAATGAACAAAAATAACTT
CTAGTTAGAGCAAAAAAGACTGCTCCAAGTACTTAAAATAATAGAGCTGGCGCACAAGGT
AATATGGGTTTAGGTGCTGGACCAGCCCCTAAATGGAAAAACTAAAGTGAACAATTTCGA
ATGGCAATGAGAGCAGCCAGAGGTGCACCTACTTAACAATCTTATGGTGGTGGCAGTGGA
TATGGGAATGCAAGAGCTGGAGTAGGTAGAAGTGGCAATGCTGGAAATGGAGGATATCAG
CAGTAAGTAGATCAGTATGATGATAGAAAACCATGCCCTTATTGTGGCAGAAGATTCAAT
GACACAGCTGCAGACAGACACATCCCACATTGCAAGACTAAATCACTAGAAATTAACAAA
AGAATGGGGCCTTAAAATAGCAATAGAGGAGGTATGAGTAGAGGGACATTGAGAAGATGA


>Contig17080.0.g15(protein)
MSQAQEWAEKKKQQLEKAKLIKEERKAASQIRQSIKSQANEGGSAGSGGFSMRPQSNHQQ
NRLGSALQQKQNTSSYSNLPQNNGRQGINSQQQFQSDYNKNNGYEIQGHKPQIRQTVGGG
IGSSNFSKISGNVNTNIDFGYLNHQSQSNMNQDSYRKVMQQQQPQDNARPLQSKVSQQKP
MQNYYQEEQKVQSRITTKPPAMTSNSNFNRPSSGIPQQKMQSNNTVSKRPQSGVKRPELG
YASQMIRNDEFNDGFQDQQQPRKQIQQKKVVSKPPARMPPSMAFQQPKDMNLNECKSCGR
SFNDEAYAKHSRICKKVFQTKRKVFNSQAKRIISNEQKQLLVRAKKTAPSTQNNRAGAQG
NMGLGAGPAPKWKNQSEQFRMAMRAARGAPTQQSYGGGSGYGNARAGVGRSGNAGNGGYQ
QQVDQYDDRKPCPYCGRRFNDTAADRHIPHCKTKSLEINKRMGPQNSNRGGMSRGTLRR