Identifiers and Description

Gene Model Identifier

Contig14147.0.g89

Standard Name

C2HC1a

Aliases

Contig14147_0_g89

Description

zinc-finger of a C2HC-type

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000757603.998693556225637e-29Zinc finger, C2H2 type family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14147.0.g89(coding)
ATGAGTGTTAGAAGAAATGCTTCAGTTGAAGCTAATGACTGGGCAGACAAGAAACGTTAG
CAGTTAGAGAGAGCTAAGCAACTCAGAGAAGAGAGGAAAAACAATATAATGAGGGTGGCT
GAGGATTAAATAGTCGGTACCTCATCTAAGGGATTTGCATCTGGTCATAATGCTGGATCA
AGTGGCTACGGAGGTGGTGGCATGGATAATGGCTTTAGTAACTAAGGAGGTTATGGTTAG
TAATAGTATGGAGGAGGACAGGAATTAGGCTATGACATGAATAAAGGAAGTGGTGGTTAC
AATAACAGAAATGGTCCAGGGAACTATGGTGGTGCAAATAGTGGCTATAGTATGGGTGGA
GGAAACTAATTTGGCACTGGTGAATTGAGAAACATGGGTTATTAAGCTCCTAATGGCGGC
AGAGGACCAGTTAAGGCTACTGATTTTGGAAATGGAGGTGGAAGCATGAGTGGTTACGGA
GGAAATGGCTATTCAAACAGTAAAATAGGAGGTGGTAATTCTGGCTACGACTAATATGAC
TAACTTAACTCAATTTCAACAAAAAGCAGTCTGTAGACCAATTAATCACTTAAAAGCCAG
CCTAGAGTTAGTTAGTATGCCAATTAAAATCCGCAAGACTACAACCCAAGCGGAAACAGA
AACTCTTAACTGGATTAACAACGAAAGTCGGTTGCAAACAACCGAAACCCTTCTCAACGA
ACTATAGACTACAATGAAACGTAAAATAGTCATTAAAACACTAATGGAGGGGGTTTCGGG
GGAAATAATAGAAACATGAATAATACTAGAACTATAGAAGAACACAAATCTAATTATTAA
CCTCAGAAGCGAGAAGCTCCTCCATAATAAAGAAGAGGCATGGCTTCAAATGCACCTAGA
AATGCTGCTGCAAATAGAAATCAAAATAATTAACAAAGCAGTAATAATAATGGGCCATAG
TATGTAAACTATGATGATGAAGTGTCCAAATAAGTCATTCCTGCAGTTGCCAGAAAGCAA
GGTGGGTATGGCAATAATCTAGGACCTGAGGCATTTTAAGCTCCTTCAAATATGGATCTA
AGAGAATGTGGTGGATGTGGAAGATCATTCAACCCAGAAGCTTATTCAAAGCATTCAAAA
ATCTGTCAGAAAGTGTTCTAAAAGAAGCGTAAAGTGTTTAACAGCTTAGCCCACAGAATA
GTATCCAAAGAATAAGAGAAAATTCTTGCCTAAGCTTAGAGATAAGAGCGTGTAGGTGCA
CCTGGAAGAGGTGGAGCATAGAATAAACCGGCAGCAGTAAACAATAGAAACAATATGCCT
GTGCGAGGAGGTGGAGCTGGATAACCTAAATGGAAGAACTAATCAGAATAATTCAGGTAA
GCCATGAGAGCAGCAAGAGGCGTAGATGATAGAAGAGGCGGTGGCGGCAAGAACGGAGGC
GGTAGCAGTTATTAGCCTCCTGCTGTTGATTAGTACGATGATAGAGTGCCCTGCCCATAC
TGCGGAAGGAAGTTTGCAGATGTTGCAGCTTAAAGACATATACCATACTGCCAGAATAAA
TCAAAGGAAAGCGCCATGAGAGGTGGTGGTCCTCGTGGAGGTAGAGGCGGCATGAGACGT
TGA


>Contig14147.0.g89(protein)
MSVRRNASVEANDWADKKRQQLERAKQLREERKNNIMRVAEDQIVGTSSKGFASGHNAGS
SGYGGGGMDNGFSNQGGYGQQQYGGGQELGYDMNKGSGGYNNRNGPGNYGGANSGYSMGG
GNQFGTGELRNMGYQAPNGGRGPVKATDFGNGGGSMSGYGGNGYSNSKIGGGNSGYDQYD
QLNSISTKSSLQTNQSLKSQPRVSQYANQNPQDYNPSGNRNSQLDQQRKSVANNRNPSQR
TIDYNETQNSHQNTNGGGFGGNNRNMNNTRTIEEHKSNYQPQKREAPPQQRRGMASNAPR
NAAANRNQNNQQSSNNNGPQYVNYDDEVSKQVIPAVARKQGGYGNNLGPEAFQAPSNMDL
RECGGCGRSFNPEAYSKHSKICQKVFQKKRKVFNSLAHRIVSKEQEKILAQAQRQERVGA
PGRGGAQNKPAAVNNRNNMPVRGGGAGQPKWKNQSEQFRQAMRAARGVDDRRGGGGKNGG
GSSYQPPAVDQYDDRVPCPYCGRKFADVAAQRHIPYCQNKSKESAMRGGGPRGGRGGMRR