Identifiers and Description

Gene Model Identifier

Contig7724.0.0.g58

Standard Name

C17orf85a

Aliases

Contig7724_0_0_g58

Description

Protein of unknown function (DUF2414)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10309 ) Protein of unknown function (DUF2414)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005264200.000000000010004361180063202hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7724.0.0.g58(coding)
ATGGAGGGATTATCTGTTGAGGAGCGAAGAAAATTGAGAGCTGAAAAATATGGAATTAAT
GTGGAGGAGCAGTAACAAGAGCTTAGGAATTAATCTTAGAATCTCTCGAAGGTTCGTTTG
AATAACGAAACCAGATTGATAGACGATAGGCCAACCATGTCAGTGGAAGATCTCGAGAAT
GAAATCAAGCGTCTTTAAGATCGCTAACAAAAATTCGGTGGTGATGTCACAGACGAAGCC
CAGAAAAGATTAGAAAAACTCTAACGCAGATTGGATTTCGCCAGACACAAGGAAGCCCCA
CAACCAATACTAAGTGAAAGTGAGATCAGTCCTGATACCTTGTATCTCTATGGAGTAGAC
TACATGAGCACAGATGATATTTAGAGTTACATTGGTGATTAATTTGGAGGAGAGTCAGGA
GTGCAGATTACTTGGATTAATGATTCTTCCTGTAGAATCAAATTCGAGAATGAGTAACTT
GCCTAGAGAGCTTACTAACTCTCTTCTATGTCTTCTAACACAGACTAGAGGACAAAGCTG
ATTATTGGAGAGGCTATGGTGGATGTTCAAACTGAAGGAGTAGACCCCAGAAACTTCGAT
GTTAACGTTGGATGGAAAGAGGCTTTTGGCTTCTAGTTGAAGACAAATGGCAGAATGCAG
AAACTTTGGATGAGGTTCGCCACTGACAAGGATTTTAAGTCAGAGAACACTAAAGGAGAG
AATAGTCGTTACTACACTATATAAAAGCAGAGAAGAGACTATAAGATGAAGCAGTATGGC
TATAAAGATAAGAGAGGAGGAAGAGATAACAAAGGAGGACCAGACAACTCTAACTTTATC
AAGAAAGCTATTAGTAAAGGGGACAAGTTTTAAGGAAATTTGAGAGAAAAACTAAGAGCT
AACCAGGGTGATGATTGGATCGGTGGAATTGAGAAGCCTGAGCAGAGCGTAAATGCAGGA
GATGCTTTAGAAAACATGGAAATGTATAATTAATTCAGTAATAATTTTGTAATAAAAACA
TATTTATTTCTCTTATGA


>Contig7724.0.0.g58(protein)
MEGLSVEERRKLRAEKYGINVEEQQQELRNQSQNLSKVRLNNETRLIDDRPTMSVEDLEN
EIKRLQDRQQKFGGDVTDEAQKRLEKLQRRLDFARHKEAPQPILSESEISPDTLYLYGVD
YMSTDDIQSYIGDQFGGESGVQITWINDSSCRIKFENEQLAQRAYQLSSMSSNTDQRTKL
IIGEAMVDVQTEGVDPRNFDVNVGWKEAFGFQLKTNGRMQKLWMRFATDKDFKSENTKGE
NSRYYTIQKQRRDYKMKQYGYKDKRGGRDNKGGPDNSNFIKKAISKGDKFQGNLREKLRA
NQGDDWIGGIEKPEQSVNAGDALENMEMYNQFSNNFVIKTYLFLL