Identifiers and Description

Gene Model Identifier

Contig5865.0.g49

Standard Name

BUD13

Aliases

Contig5865_0_g49

Description

Pre-mRNA-splicing factor of RES complex

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam09736 ) Pre-mRNA-splicing factor of RES complex
  • ( pfam10500 ) Nuclear RNA-splicing-associated protein
  • ( pfam11138 ) Protein of unknown function (DUF2911)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010714503.0002687256732656e-20hypothetical protein
SGDYGL174W0.00000005001214305021125BUD13 SGDID:S000003142, Chr VI
I from 174545-175345, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5865.0.g49(coding)
ATGGGTGGTGGTGGCAAAACTAGCTCAAGTGGTAATAACTAAGACGAGTTGAAGAAACGA
CTCTTGAAATAGATGTAGAAGTAGAATTAAAATCCAAACACAATTGGATTATCTTCTAAT
CAGAAGAAAGTGGGTAATAACTTCAGGGATGAGGATGAATCAGTGATTTAAGTAGGCATG
GACTATAAAAAGCAAAAGCAATAGCAACAACAAGTAAAATACCAAATTAACTAACAACAG
CTTCTAATGAAGTACCAACAAGCTTAATAAAAATAATAAAAACAAGGTTTTAAGGCTTTA
GAGGAAGATGTCGATGATAATGATAAAGATGACAGTGATAATGATGAAGCGCCTAATGTT
ATATTTGAAGGGGGAGATATGGGTCTTAATGAGGATGACAAAAAGCTACTGTTCAAGCAA
GGAGAATTAAGACTCAACTAATCATAGAATTTACCATAAAAAGCGATGATTGGAAACAAA
ACTGACAAAGATAACAAGAAGAATGACACTAAGAAACGCCGTAGACACGATAGTAGTGAC
GATTCTTCTGATAATAGTTCAAGCTCAAGCGATAGTGATGAAAGTGGAAGAAAAGGGAGG
AGAAAGCGCAGAAGACATGACAGTGATTAGTCCAGTGATGATGATTAAGTCTAGATTGAT
ACCTCTACTAGAAAACCAAGAGTTGACAAAGGCAATTCATAATTTTAATTTAAACCTTTA
TTTTTAGATGGAGATTTGAGTTTATCAGAAGAGGAGCACTCGAAATCAAAGCTAGTTGAG
AAAGCAGGTCTGTAAACTGCGAAAGACTTGAAAGATTTTAATCGTTTAAGAGATTAAGAA
ACTAACAAGCAGCTTATGGAACAGATCTAAAAAGAGGGAGGAAGAAACAATTAAACTGTG
TACAGAGACAAGAGTGGGTTGAAGGTAGACATGAAAGATAAGATGGTTTCTGAGAAAGAC
AGACTGCGAATAGCAAATGAGTAATAACTCAAATAATGGAGAGGGGGCGCTAAACAACAG
CAAGAACGTGAGGAGATGAAACAAAAAATTCAAGAAGCCAAGAACCAGCCATTTGCCATG
CATGATCTCAATGAAAATGCAGATTAGGAACTACAGCAGAAAGATAGATTTGGAGATCCT
TTGAAGTTGATAAGAAGCAGCAATATGAGATCGAACCTGACTAAGCAAATGTACAGAGTG
ATTACAACTGCAAGTGGCTATAAATTTCTGTTGCCTAAATGTAAATTTCCTGGACTTGGC
AATAGGTTTGATATTGAACCTGGGCATAGATGGGATGGTGTGGATAGATCAAATGGGTAT
GAAAGAAAATGGATTGAGAAAGAAGCCTCTAAGAAAGATAATCAAGATTTCTTCAGAAAA
TGGGCAACTGAGGATATGTGA


>Contig5865.0.g49(protein)
MGGGGKTSSSGNNQDELKKRLLKQMQKQNQNPNTIGLSSNQKKVGNNFRDEDESVIQVGM
DYKKQKQQQQQVKYQINQQQLLMKYQQAQQKQQKQGFKALEEDVDDNDKDDSDNDEAPNV
IFEGGDMGLNEDDKKLLFKQGELRLNQSQNLPQKAMIGNKTDKDNKKNDTKKRRRHDSSD
DSSDNSSSSSDSDESGRKGRRKRRRHDSDQSSDDDQVQIDTSTRKPRVDKGNSQFQFKPL
FLDGDLSLSEEEHSKSKLVEKAGLQTAKDLKDFNRLRDQETNKQLMEQIQKEGGRNNQTV
YRDKSGLKVDMKDKMVSEKDRLRIANEQQLKQWRGGAKQQQEREEMKQKIQEAKNQPFAM
HDLNENADQELQQKDRFGDPLKLIRSSNMRSNLTKQMYRVITTASGYKFLLPKCKFPGLG
NRFDIEPGHRWDGVDRSNGYERKWIEKEASKKDNQDFFRKWATEDM