Identifiers and Description

Gene Model Identifier

Contig20709.0.g68

Standard Name

BUB1

Aliases

Contig20709_0_g68

Description

Mad3/BUB1 homology region 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20709.0.g68(coding)
ATGGATCATTAATCAAACATTACTACCACTAACTAAAAAGTCTGTGAAAGTAATGTTAAT
ATAAACCCGACTAATGAAGCAATTTTTTCTTATGATTTGGACTCACTTCTAGATACCCCT
TCAAGACCTAATGTTACTATGACTGTTGCTCAATAAATTGATCTTTGGAGAATCTATATA
AACTAACAGGGAAAGTTTGGGAGTACTGCGCATTTTCTTGCGATTGAGAAGTTGGTCTAA
GCATTTTAAGATTAGGAGCAATTCTTTTCCAATAGATTTTACACTGAAGTATGGATTAAA
TATGCTTAGAAAGTCAAGAATCCTTAGGATGTGTACGAAACTATGCTACATCTTAAGATT
GGCGCATGTTTCAATTCCACTTATGAGAAGATTGCCAATTATTTTGAGTTTGAGGCACTT
GATTACCGAAGAGCAGATAAAATCTATAGAGTTGGCTTGTAGGAGTTAATAGCTTTAGGT
GAAGAAAAAGGAGATTAGCAGTTATAGAATCTATAGATGAAGTACAGGATATTCACTGAG
AGAATGAAAACAAGAGTCGAAGCTGAAGTAGGTTCTGAGATCAAGTAAATTAAGAGCTCA
AAGTGGACTTATAGAGAGAAATCCAAAGCTCAACTAATCAGGAAGAATCATGAAAAAATC
TATGCGAATTCCCGTCGAAGCTACACAAAAAACTAAATCATTCTTGGAGGAGTTCCTATT
TATGTTGATGATGAATTTCGCGAGGAAGTTATTCCTTCTGGAACTAGAGAAGTAGAAAAG
TTCTATGATCATCTTTCATTTTTGGATGGTATCGAGAAAAAGGAATTGCAGCCTTAGAAT
GATCAAATTTCTGGTGGAAAACTTCAGTTACTTTAAATCTTTAAGAATCATGAAATGAAG
AAATCAGACCAATAATAAGATACAACCAACTACTTTGTTTAATAATTGACCAAGAAGAGA
ATCGATTTAGAACGAGATAGCCAGCTAAAGCATGATTCTTACCTTGATCGTTAACCCTTC
ATGAAACTAGAATACAAATCTGGAATAAATCCCTTCTTACAGTAGCATTAAATTTTAGAG
AAAGATATTCATTACGATTTAATCAATAATGAATCACTTATTGAGAATTAAAGCCCAAAC
TTTTCTGAAATTCAAAGTCAATCTTCATCAAACTCACAATCTAAGTAGAATCGTAAAAGA
AAAAGTCATCTAACAATTCAGCGCAGATAAGAAAGTCAAAATTAAACTCAGTCCTAATAA
ATCCAAGTAATAGGACAAACCCCCTTTAAATCTTAGTTCCTTTCTCCTATCAGTTCAGTT
AGTAAATAAGTGTAAAACTGCAATAACCAACAGATGTCATCACACTGTAACTTTGATAAC
TATGATGGTGAATTCAGTGGAGTTCCTTCTGACATTTTTGGTGATTGCTAAAGCTAGGAT
GCAAGTAATTGCATGAGGGGGGTTACTTTTGGAAATAACTAATAGCTTGGTTTTTCTTCT
TCAAATCATAATGTTAATAGTAGAAGAGTGGGGAGCAAGTTCAGCATGTCTACTATCAAA
GAAGTTCCTTCATTAGATCAATCATCATACTATAACTGA


>Contig20709.0.g68(protein)
MDHQSNITTTNQKVCESNVNINPTNEAIFSYDLDSLLDTPSRPNVTMTVAQQIDLWRIYI
NQQGKFGSTAHFLAIEKLVQAFQDQEQFFSNRFYTEVWIKYAQKVKNPQDVYETMLHLKI
GACFNSTYEKIANYFEFEALDYRRADKIYRVGLQELIALGEEKGDQQLQNLQMKYRIFTE
RMKTRVEAEVGSEIKQIKSSKWTYREKSKAQLIRKNHEKIYANSRRSYTKNQIILGGVPI
YVDDEFREEVIPSGTREVEKFYDHLSFLDGIEKKELQPQNDQISGGKLQLLQIFKNHEMK
KSDQQQDTTNYFVQQLTKKRIDLERDSQLKHDSYLDRQPFMKLEYKSGINPFLQQHQILE
KDIHYDLINNESLIENQSPNFSEIQSQSSSNSQSKQNRKRKSHLTIQRRQESQNQTQSQQ
IQVIGQTPFKSQFLSPISSVSKQVQNCNNQQMSSHCNFDNYDGEFSGVPSDIFGDCQSQD
ASNCMRGVTFGNNQQLGFSSSNHNVNSRRVGSKFSMSTIKEVPSLDQSSYYN