Identifiers and Description

Gene Model Identifier

Contig12717.0.g75

Standard Name

BTU7

Aliases

Contig12717_0_g75

Description

Tubulin/FtsZ family, GTPase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00091 ) Tubulin/FtsZ family, GTPase domain
  • ( pfam03953 ) Tubulin C-terminal domain
  • ( pfam10644 ) Misato Segment II myosin-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003485101.0003279799459891e-139Tubulin beta chain, putative
SGDYFL037W1.0000620911535021e-130TUB2 SGDID:S000001857, Chr VI
from 56336-57709, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12717.0.g75(coding)
ATGAGAGAAATTATTTCCTTACAAGTTGGTTAATGCGGTAACCAAATCGGCTATAAATTT
TGGGAGAATATAACTTAAGAACATGGAATAGATACAAGCACTGGTTAATTTTACGGCAAC
TCAGATTTGCAATTGCAGAGAGCAAACGTTTACTTCAATGAAATCGAGAATAACTACAGT
GAACACGGGACTACTAACAGGTATGTACCTAGAGCTTTACTTATTGATCTTGAACCAGGC
GTTCTTGATTCAATCCAATCTCAATCATCAGCTTTATCCCACTTATTCAACCCTGACAGC
TTCATTTCTGGAATGAACGGTGCTGGAAATAATTGGGCAAAGGGCTTCTACAGCGAAGGC
AGTGAGTATATTGGTTAAATTATGGATTCAGTCAGAAAAGAAGCGGAAAGATGTGAGGCA
ATGCAAGGCTTCTAGATTGTTCACTCACTTGGTGGAGGTACCGGATCTGGTCTTGGAAGC
AATATCCTCAATATTCTTGAGCAGGAGTACTCAAATAAAATACTAAGCAATTTCTCTGTG
TACCCTGCTTCTGCTTCTTCTAATGTCCTTGGTGACGGCTCATCGTAGCTATCAGATGTT
GTTGTCGAACCATATAACACAATGTTTTCATTGAACTGCCTGGTTAATACTTCACATTTG
AGCGTAAACATTGATAATTCTGCCCTTAACAGAATTTGCACTCAACAGCTGAAACTAAAG
CAACCATCATTTGCTGATATTAACTATATCATAGCTCAAAGCATGAGTATGGCAACTTCA
ACAATGCGTTTCCCAGGGGCTTCAAACAACTCAGACCTCAGGAAGCTCTGCACAAACCTA
ATCCCCTTCTCCAGACTTCACTTTATTTCGAGTGCTCTAGCTCCACTTATTGGTAGAGGT
GAGTAGAAATATGATAGACTTGGTGAGAAGGAAATTCTGGATAGACTGTTTAGTGGGTAG
AGCTTCATTAGTGATAACAATATCAAGACTGGCAAGATACTAACTGGTTCAGTTATGATG
CGAGGTTAAGACGTCTCTGAGTGTGAATTAGAAACATAAATGAAAAGATTGTGTGATAAA
AATTCCTCCACTTTCGTAGAATGGATCCCTAATAGACTCATGAGCACTGTATGTCGGGTG
AATCCTTCAACCACAAACGCAATGACTGGTGGATGCTTGATTAATTCAACTAGCATTATA
TCATAAATGCAAAAAATGGCAAATAACTTCGAGAAAATGTTTGCCAGGAGGGCTTATGTG
CACTGGTACACTCAAGAGGGTATGGACGTTTAAGAATTCGATGAGACACTTAATAACATC
AGAGATATGATTAGCGAGTATTAATAGTATCAAGATAGTGGCTCTGGGGAGGACGATGAA
GCGCACATGTTATATGAAAAATAAAGCAATACTTCTAGTAAAACGGCATCTAAAAGTCAT
GGTTTGAACACCACTAGAGCCTCTAGTAGAGCCTAAGTCTGCGATGATGTTGAGATGGAA
GATGTAGAAGATTTCGAGGAGGAAATGGTATGA


>Contig12717.0.g75(protein)
MREIISLQVGQCGNQIGYKFWENITQEHGIDTSTGQFYGNSDLQLQRANVYFNEIENNYS
EHGTTNRYVPRALLIDLEPGVLDSIQSQSSALSHLFNPDSFISGMNGAGNNWAKGFYSEG
SEYIGQIMDSVRKEAERCEAMQGFQIVHSLGGGTGSGLGSNILNILEQEYSNKILSNFSV
YPASASSNVLGDGSSQLSDVVVEPYNTMFSLNCLVNTSHLSVNIDNSALNRICTQQLKLK
QPSFADINYIIAQSMSMATSTMRFPGASNNSDLRKLCTNLIPFSRLHFISSALAPLIGRG
EQKYDRLGEKEILDRLFSGQSFISDNNIKTGKILTGSVMMRGQDVSECELETQMKRLCDK
NSSTFVEWIPNRLMSTVCRVNPSTTNAMTGGCLINSTSIISQMQKMANNFEKMFARRAYV
HWYTQEGMDVQEFDETLNNIRDMISEYQQYQDSGSGEDDEAHMLYEKQSNTSSKTASKSH
GLNTTRASSRAQVCDDVEMEDVEDFEEEMV