Identifiers and Description

Gene Model Identifier

Contig625.0.g44

Standard Name

BTU6

Aliases

Contig625_0_g44

Description

Tubulin/FtsZ family, GTPase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00091 ) Tubulin/FtsZ family, GTPase domain
  • ( pfam03953 ) Tubulin C-terminal domain
  • ( pfam00433 ) Protein kinase C terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYFL037W6.000287828677204e-80TUB2 SGDID:S000001857, Chr VI
from 56336-57709, Genome ...
T. thermophilaTTHERM_003485103.999329394025902e-72Tubulin beta chain, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig625.0.g44(coding)
ATGAAAGAAATTTTGACTTTAGGTATTGGAGGATTTGGAATAAATTCATTAGATTTAATT
AATCAGGACTTATCTGAGGATCATAATATTGGTCTGGATGGATAGGTTTTGAAGGAAGAT
TCTTATGGTAATCACTATCCTGAAACATACTTCCAGGAGATGTCAAATGGAAAATATTGT
GCAAGATCGCTGCTTATTGATGGTGATGACATGGCTATTGACAATATTCGAAGTGGAGAT
TCCGCAAATATGTACATGCTTGACAACTATTCATATTCTAATATTTAAAGTGGAGGACTG
TTCTCAAAGGGGTGTTACAGTGTAGATTCTGATTTTATTGAAAGTGTCAAAGAAAAAGTC
AGAAAATCTTTAGAAATGACAAACTAATGCTTGAGTGTTGAATTTCATTTCGCTTTTGGA
GGTGGAATAGGCTCTGGCCTAGGATCTAAATTGTTGTAAGAAATTAATGAAAATTTTAAA
GGTTTTTCTTATGTTGGAAGCAATCTTTTAAGCAATCTAAAATTTTCTCAACATACTCTA
GAACCATACAACACTTGCCTTTCCATGAATAATCTGGTGGAATTCTTGGATGGAGTGACT
TTATTCGATAATTATGCATTAAATAATGTTTGCCAGAGATAGTTTAAGATTCCATAACCC
TCATTCGAAGATTTCAATACTTTAATCTCCTAGTATAATTGTACATTAACAAGCACATTA
AGGCATCCTTCGACTTAAATGAAGAGCTATAGATAGATTTTGACATCTACAATACCCTTC
CCACGAATCCATTTCATGTCACCATCATTAGGTAATTTAACGCCAATGTTTAATGAAGAA
AAAGAGAAATAAGACGAAGATAAAATTATTGAAGATTTATTTGATTGTAGGAACTTCCTT
TTAGATGTTAACCCGAAATAAGGGAGATATTATACTTATGCCTCCATATTTAGAGGAAAA
AAGTACTCCGATATTGATATAAAATATAAACTTAGGAAAAATCAATCAACAAATAGCAGC
TATTTCGTTGAGTGGCTACCTGATCATAATGCCACTAGTGTAATTTCAAGAGATTTTGAA
TCAAATCCAACTAATTAAGCAGTATTGTATGGTAACAACTCTGCTGTCAAAGAATGCTTC
ACTGCTATAGGAGATCAATTCACTAAACTATTTCGCAGGAAGTGCTATCTCCACAAATAT
TTAGAAGATGGAATGGACGAAATGGAATTCACAGAGAGTGAAAGCGCTCTTAACGATTTA
ATTAGTGAATATTAACCTTTCAACAATTCTTATGGAGAAGAAATTGAGGAAGATGAGTAT
TGA


>Contig625.0.g44(protein)
MKEILTLGIGGFGINSLDLINQDLSEDHNIGLDGQVLKEDSYGNHYPETYFQEMSNGKYC
ARSLLIDGDDMAIDNIRSGDSANMYMLDNYSYSNIQSGGLFSKGCYSVDSDFIESVKEKV
RKSLEMTNQCLSVEFHFAFGGGIGSGLGSKLLQEINENFKGFSYVGSNLLSNLKFSQHTL
EPYNTCLSMNNLVEFLDGVTLFDNYALNNVCQRQFKIPQPSFEDFNTLISQYNCTLTSTL
RHPSTQMKSYRQILTSTIPFPRIHFMSPSLGNLTPMFNEEKEKQDEDKIIEDLFDCRNFL
LDVNPKQGRYYTYASIFRGKKYSDIDIKYKLRKNQSTNSSYFVEWLPDHNATSVISRDFE
SNPTNQAVLYGNNSAVKECFTAIGDQFTKLFRRKCYLHKYLEDGMDEMEFTESESALNDL
ISEYQPFNNSYGEEIEEDEY