Identifiers and Description

Gene Model Identifier

Contig5998.0.g63

Standard Name

BTU2

Aliases

Contig5998_0_g63

Description

Tubulin/FtsZ family, GTPase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00091 ) Tubulin/FtsZ family, GTPase domain
  • ( pfam03953 ) Tubulin C-terminal domain
  • ( pfam10644 ) Misato Segment II myosin-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003485109.997093137033517e-262Tubulin beta chain, putative
SGDYFL037W9.997093137033517e-262TUB2 SGDID:S000001857, Chr VI
from 56336-57709, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5998.0.g63(coding)
ATGAGAGAAATCGTTCACATCCAAGCAGGTCAATGCGGTAACCAAATCGGTGCCAAATTC
TGGGAAGTCATCTCCGACGAACACGGAATTGACCCCACCGGAACCTATCACGGTGACTCA
GATCTCCAACTCGAGAGAATCAACGTTTACTACAACGAAGCCACTGGAGGAAGATACGTT
CCAAGAGCTGTACTTATGGATCTTGAGCCAGGTACCATGGACTCCGTAAGAGCTGGTCCA
TTCGGTCAACTCTTCAGACCAGACAACTTCGTCTTCGGTCAATCCGGTGCCGGTAACAAC
TGGGCCAAGGGTCATTACACCGAAGGTGCTGAGCTCATCGACTCAGTCCTCGACGTCGTT
AGAAAGGAAGCTGAAGGTTGCGATTGCCTTCAAGGTTTCCAAATTACCCACTCACTCGGT
GGTGGTACCGGTTCAGGTATGGGAACCCTCCTCATCTCAAAGGTCAGAGAAGAATACCCA
GACAGAATCATGGCTACTTTCTCAGTTGTCCCATCACCAAAGGTCTCAGATACCGTCGTT
GAGCCATACAACGCCACCCTTTCAGTTATGTGCATTGATAACGAAGCTCTTTATGATATC
TGCTTCAGAACTCTTAAGCTCACCACCCCAACCTACGGAGATCTTAACCATTTGGTCTCT
GCTGGTATCTCAGGTGTTACATGCTGCCTCAGATTCCCAGGTCAATTGAACTCTGATCTC
AGAAAGCTCGCCGTCAACTTGATACCATTCCCAAGACTCCATTTCTTCATGACTGGTTTC
GCCCCACTTACCTCAAGAGGTTCTCAACAATACAGAGCTCTTACCGTACCAGAGCTTACC
CAACAAATGTTCAACGCCAAGAACATGATGTGCGCTTCTGACCCAAGACACGGTAGATAT
CTTACCGCCTCCTCTCTCTTCAGATGTAGAATGTCAACCAAAGAAGTCGACGAACAAATG
TTGAACGTCCAAAACAAGAACTCATCTTACTTCGTTGAGTGGATCCCCAACAACATCAAG
TCATCCGTCTGCGATATCCCACCAAAGGGACTCAAGATGGCCGTTACCTTCCTCGGTAAC
TCCACTGCCATCCAAGAGATGTTCAAGAGAGTCGGTGAGCAATTCACTGCTATGTTCAGA
AGAAAGGCCTTCCTCAATTGGTACACCGGTGAGGGTATGGACGAAATTGAATTCACTGAA
GCCGAATCCAACATGAACGATCTCGTCTCCGAATATCAACAATATCAAGACGCCACCGCT
GAGGACGAAGAAGAAATGGACGAAGAGCAAATGGAATGA


>Contig5998.0.g63(protein)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGRYV
PRAVLMDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAEGCDCLQGFQITHSLGGGTGSGMGTLLISKVREEYPDRIMATFSVVPSPKVSDTVV
EPYNATLSVMCIDNEALYDICFRTLKLTTPTYGDLNHLVSAGISGVTCCLRFPGQLNSDL
RKLAVNLIPFPRLHFFMTGFAPLTSRGSQQYRALTVPELTQQMFNAKNMMCASDPRHGRY
LTASSLFRCRMSTKEVDEQMLNVQNKNSSYFVEWIPNNIKSSVCDIPPKGLKMAVTFLGN
STAIQEMFKRVGEQFTAMFRRKAFLNWYTGEGMDEIEFTEAESNMNDLVSEYQQYQDATA
EDEEEMDEEQME