Identifiers and Description

Gene Model Identifier

Contig18482.0.g69

Standard Name

BROMO6

Aliases

Contig18482_0_g69

Description

Bromodomain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00439 ) Bromodomain
  • ( pfam12977 ) Domain of Unknown Function with PDB structure (DUF3861)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR399C0.000009002574193719714BDF1 SGDID:S000004391, Chr XII
from 921596-919536, Geno...
T. thermophilaTTHERM_000731700.0004000184047659232Bromodomain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18482.0.g69(coding)
ATGGAATTGTTTCCATTTATGAAGGAGAACGTAATAATTGACGATAAAGAAAACAAAATG
ATGCTGCCTAAATAACACATGCAATTGTTTCTTAATATTATGGCTTCAATTAAACCAGAG
ATTAAACCCATTGCATAGGCTTATCCAAATATAGCCTTTAAAAGGTTTATAAACTATAAA
GTGCCATAGTTTAATGAGGAGACTTAGAAGCCAATCTTACTTATCCGTAGACATGATTTG
AATTTGCATAAGTATGATACTAGAAACAAGAATTTATTTAAAATCATTGACAACTAAGGA
GAATACATTGATCCTTTAGATCTTGATATGCTAAAAAAGAAGCAGCGTTTAGATATGTAA
AATTATAAGCAACCTCAACCAAAATGGATGAATTTCGCTTGGGATGCCTTTAGAATAGTG
GATAATCACAGCAAGAGTATGATATTTATGATGCCAGATGAGCCCAAGAACGAGGAATAT
TTGGAATATATGAGCAAAGTTGAGAGGCCAATCTCCCTAGAGACTATTAGAGTAAATTTT
ATCATTTTACTTAAATTAATTGTTTAGAACAAGCTGAATACAAGGAATTATACAGTGTTT
GAAGAGTTCATAGAAGACATGAACTTACTCTTTGATAATTGGATCAAGTTTAGAGGAATA
GACCACAAAATGTATAAGTATTGTGATGCAGTACAGAAGAGATTTGATAAGTTTGTAGAA
AAAGCAAAGCAAAAATCAACTGTATAAAATGAATGA


>Contig18482.0.g69(protein)
MELFPFMKENVIIDDKENKMMLPKQHMQLFLNIMASIKPEIKPIAQAYPNIAFKRFINYK
VPQFNEETQKPILLIRRHDLNLHKYDTRNKNLFKIIDNQGEYIDPLDLDMLKKKQRLDMQ
NYKQPQPKWMNFAWDAFRIVDNHSKSMIFMMPDEPKNEEYLEYMSKVERPISLETIRVNF
IILLKLIVQNKLNTRNYTVFEEFIEDMNLLFDNWIKFRGIDHKMYKYCDAVQKRFDKFVE
KAKQKSTVQNE