Identifiers and Description

Gene Model Identifier

Contig18011.0.g12

Standard Name

BROMO5

Aliases

Contig18011_0_g12

Description

Bromodomain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004995300.000000000006001570085597868Bromodomain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18011.0.g12(coding)
ATGGATGCCTAGAGTCTAAATAAACTACAAGAATATAACGAAGAATCGAAAGATGATCAA
CGTGATGGCCAGAGAGATATCATGGCAAACTTACTTCAGATTGCAGTAATCAACAAACTA
CTTCCAAAGGGATTTAAATTTGAGTTATATGAGACTGTAAAAAGATAAAATGACTCAAAT
ACAAGTTAGAGAGCTGCTCCTTAAAAAAGAAGAAAGAATTAGAACACAGATGCTGAAGCA
GGGGATGGAGGATCAATTATTGGAGGAGAAAGCTTCATTCACAATGGAAAGAAGTCAAAG
GATTCAAGAAGTGGAAATGATAACGAAAATAGTTCATAAACCAATAACTCTAATGGAAAT
TAAAGATCATCATAAAGTGCCAATTAAATGAATAAAAGGGTTTCTCAAAGATAAAAGAAG
CCAACCAATTTTGAAGATTTAGGATATGAAGAAAAGGGCGCTAAAAAGACTAAGACTACT
ACAATTTGGAAAGAGTGCTATGGAAAGTGTGAATCACTTATCTAGTAGATAAGGAAATTA
CCAGGAGCTGAATACTTTGCAAGACCTCCAAATTCCGACCACTAATTCTACACAGAGATT
ATGCATGACTATATAGACTTAGGATTAGTGGAAAGAAAGTTCAGATAGGGTGATTATCAA
AGCTCAATTTAGTTCATTGAAGATATGAGAATGGTATGGGATAAAGCATTTTAGTATATG
AAGGACGATCCTGAAGTTTATTAAAAAGCAAAGGAGTTAAGTTCATATTTTGAATAAAAA
GTCAAAGATATTGAGTAAGTTAGCTTCAGAGAAGTTCTTTCTAAAAACCCTAATGACCCT
AATTCAGCTGCTGGAGAATTAAAAAGCAATTTGCAAAAGTATCAGAAAGAATTATCTTAA
AAAATTCAAAAAGATTAGGCAGTAGAAAAGATTTAAAGTTAAAACAAGCAGCAGTAACAA
ATTAAAGGTAAAGTTGGTTTTGGAGCTGGAGTCACTCCCTAAAATCAACCTCTCTTTTAA
ACTTCTCATTATCCTAACTAGTACTAAAATTAGCAATAAGAAGCTCCATAAAATCAACGA
TAATAGCAAGTAAGGCCATCGGATGTTCAGCAATTTAACTAAACCCCAAACGTAATCGAT
GAAGAAGAATAACTTAACAAAGAAATGCCATTTTCAGAAAGATAAACACTAGGCCATAAT
ATCCAGTTTCTATAAACTGAACAACTCTTAGGTATCGTGCCTATAATTCAAGACAAGTCT
TAAGGCCAAAAAGAAATTGTTGAATTTGATTTAAAAGAACTTCCACACAGGAAATGTAGA
GAACTTGAGAGATATGTTATGAAATGCATAAAAGAAAATTAAGAAAGAGAAACCTTGGCT
TAACAGTAACAACAACAACAAAATCTGTCCTAACAGTAACAATAATAACTCTAGCAGTAA
TAACAGTAACTATAATTGTAGCAGCAATAATAAGCTCAGCATCAATAAAGTCTACAACAG
TAAAAGTAGCAACAAGCGCAGTAATAAATTTAAAATCAACAATTTCAAAATAAGCAAGTT
CCTTCTTAGATTTAAACTCCAAGCTAACAACTGATATAAAATCAATAGAAATCACTTGTG
CAATAGTAACCAAAATAAAATGATGTATAACAGCAAATTCAATAGTAGTTATACCCAGAT
CAAAGTGGATTAGCTTAAAACCCGAATTATATGGTCTCTCCTATTAATTAACACTACATG
AATAATTTGGCACTGCAATAGCAGTAAATGATGATGGGCCAGTAAAATCCTATGAATTTA
ATAGACCCTAACTATCAATTATACTACCAGCAGCAGTAGTAATAATTACAGAACTAAGCC
CAGCAATAGGCAACAGCTGATCCAATGAAGAAATAAGGAGGATTCATGCATGATTAGCAA
AACTAATAGTAATAGTAGTAGCAACTTGCTTTCAATCAATTTGGACAGCCATAATCGACT
ACTCCTCAACAAATAGTGAACCCATATTAGTTGTAATATGCTCAAGCTTATGGTCAGCAT
ATGCAAGACGATCAATACTTGTAGCAGAATCCTCTTTCATAAAATCTGATTGCAACTGCC
CCTTTCTATGGCGGTGGACTACCTTTAAATGGGATCGACACTTTCTAATAGAATTATGCA
CAGCTAGGTCAAGGATAGCATTGGAATCAGGGAGGAGACTAAATAAATAACTCAAACCAG
GGCAATTTCAACTAATGA


>Contig18011.0.g12(protein)
MDAQSLNKLQEYNEESKDDQRDGQRDIMANLLQIAVINKLLPKGFKFELYETVKRQNDSN
TSQRAAPQKRRKNQNTDAEAGDGGSIIGGESFIHNGKKSKDSRSGNDNENSSQTNNSNGN
QRSSQSANQMNKRVSQRQKKPTNFEDLGYEEKGAKKTKTTTIWKECYGKCESLIQQIRKL
PGAEYFARPPNSDHQFYTEIMHDYIDLGLVERKFRQGDYQSSIQFIEDMRMVWDKAFQYM
KDDPEVYQKAKELSSYFEQKVKDIEQVSFREVLSKNPNDPNSAAGELKSNLQKYQKELSQ
KIQKDQAVEKIQSQNKQQQQIKGKVGFGAGVTPQNQPLFQTSHYPNQYQNQQQEAPQNQR
QQQVRPSDVQQFNQTPNVIDEEEQLNKEMPFSERQTLGHNIQFLQTEQLLGIVPIIQDKS
QGQKEIVEFDLKELPHRKCRELERYVMKCIKENQERETLAQQQQQQQNLSQQQQQQLQQQ
QQQLQLQQQQQAQHQQSLQQQKQQQAQQQIQNQQFQNKQVPSQIQTPSQQLIQNQQKSLV
QQQPKQNDVQQQIQQQLYPDQSGLAQNPNYMVSPINQHYMNNLALQQQQMMMGQQNPMNL
IDPNYQLYYQQQQQQLQNQAQQQATADPMKKQGGFMHDQQNQQQQQQQLAFNQFGQPQST
TPQQIVNPYQLQYAQAYGQHMQDDQYLQQNPLSQNLIATAPFYGGGLPLNGIDTFQQNYA
QLGQGQHWNQGGDQINNSNQGNFNQ