Identifiers and Description

Gene Model Identifier

Contig8599.0.g61

Standard Name

BROMO4

Aliases

Contig8599_0_g61

Description

Bromodomain associated

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8599.0.g61(coding)
ATGCACTAAAGAAGCGGAGGATAACATCACAGTCATGGTCATCATGGCTACTCATAAAGA
TAACATGGTCCCCAAGCGACTGTTATTTCTGACTATATCGATAAAAATTTGCAAGAAAAT
GTAGCTTTAGTATTGTTGGACAAGAATTTTTAAACCTGTGAGAATATTGCTTTGTATGCA
GTGACTGATCTAATGAAAGAGTACATGCGTGAATTAGGCAAGGAAATAAAGTCATACACT
GAACTAAATGGGCGCACAGAGTCAAATCTGATTGATACTTTGAATGCACTATACAACTAT
GACATGCCCAAAGAGAAATTAATTGAGCATATGGAGTCAAGAGGGAGAGAGCTTTCACTA
ACCCCATATAAATATGGATACTTAGAGGAACATCAGTTTGCCATGGACCGTAAAGTTCGC
TCTAAAATGGATGCCATTCAAAGTATATTCTCTGGAGGAGATTAGATAGGGTCAACTCCT
GCTAATATCAACACATCGCAACTTCCTGAGTATACCAAAAAGCTGAAAACAATGAGTTCT
ATTCCATCTCATTTGCTTAATGTGCTACCCTCTAAATTGACTTTTATGGCAGATCAAACT
TTGGCTGAGCGTGAAACTAATCCAGCCTACGAGCGAATGTAGAGAGTTCAATTCAAACGA
GAGATTGAAAACAGCATTCAGAAAGTGTCAGAGATTTAAATCGACCTTTCTCAGCAAGTT
AATGCGCAGAAATAAGAATAGTAGGTAAATTTAGTGGAAGGAGCAGTTGAGGAACTAAAA
TAAGAGTAAGCAGCAGAGGATGTTCAAATGAAAGATGCAGAAGAGTTACCATAACCCCCT
ATTAATGGAATTGATGAGTAACAATTACCAAAAGATGAAGCAAATACTCAACCAAAAGAA
CTTGTGCAGTAACAAGAAGAGGAATCTATGCAAATTGACACATCTACTATATAAGCTTAA
TAGTAGCAAGTTGAAGAGCAATAAAAAGAAGTCAAATAAATCAATTCTGCTAAAAAGAAG
AAAGAAAAGAAGTAGCCAGAAACTGTATAAAATCCCAATGAACTTTGGAGCTTTGGAGTG
GGATAAGTAACGAGCTAGAATCTAGATAATTTGTTTAATATTTGA


>Contig8599.0.g61(protein)
MHQRSGGQHHSHGHHGYSQRQHGPQATVISDYIDKNLQENVALVLLDKNFQTCENIALYA
VTDLMKEYMRELGKEIKSYTELNGRTESNLIDTLNALYNYDMPKEKLIEHMESRGRELSL
TPYKYGYLEEHQFAMDRKVRSKMDAIQSIFSGGDQIGSTPANINTSQLPEYTKKLKTMSS
IPSHLLNVLPSKLTFMADQTLAERETNPAYERMQRVQFKREIENSIQKVSEIQIDLSQQV
NAQKQEQQVNLVEGAVEELKQEQAAEDVQMKDAEELPQPPINGIDEQQLPKDEANTQPKE
LVQQQEEESMQIDTSTIQAQQQQVEEQQKEVKQINSAKKKKEKKQPETVQNPNELWSFGV
GQVTSQNLDNLFNI