Identifiers and Description

Gene Model Identifier

Contig9009.0.1.g105

Standard Name

BROMO3

Aliases

Contig9009_0_1_g105

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001423801.0004783691736523e-35Bromodomain containing protein
SGDYCR072C0.000000000006001570085597868RSA4 SGDID:S000000668, Chr III
from 242352-240805, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9009.0.1.g105(coding)
ATGGATTGGCAGGGAGAGACCCATCCTGTAAAGTTTGAGGAAGCTAAGCTGAATTTTAGT
CAGTTTGATTAAAATTATCTTACTTAGTTACTTTAAAAATAAACGGTAGAGGGAGGACAT
CAAAATAAAAAAAAAGAATGTGCACCCATTAATTCAAAAATCTCCGACATCAAAAAAACA
AAGCTGCTTATAGGAGATCATGATAACCTGCTACTCAGGGCGAAGGGACTCCATTTTGAA
AATTTTGTGACTGATCAGAAAAGAAATCTAAAAAATTATTAAATTTCCCGCTATCAGAGA
GTCAAAACAATATTTGGGCATGCTTTAATTTAAGAGGGATATAATGCCCCAATTTACAAT
GTGATTTTTGACTAAACAGGAAGCTATATCATTAGTGGAGCTGATGATGGGATCATAAAA
ATTTGGGACAAGGAGACCATGAATCTTCAAGGTTCCCTCCATAGCCATTAAGAGGTGATT
ACAGATATGGATATAAGCAAATGTAATTAGTACCTAGCCTCTTCTAGTAAAGATGGAAAA
CTAATCATATGGGATTGGAAGAAATGCTAAAAGTTAGATGAGATTGCTGCACATAATGCT
GTCGTGAATAACATCAAGTTCTACTAATTGAAGCTTAAGCAACAAGGACAACAATAAAGA
GAACCTGAAAAAGTTTAGATCTTGGTCACATGCTCTGACGATGGAACTATCAAAATCTAT
GATGAGATTAACTACATTAATTCATTAAAGCAAGCAAGTTCTTAGACCTAAGAGCAGTAA
GTCATGAGGAGATCAAGAGGAAGACATGAGGTCCAAGCTGTTAAAAAAGAGAGATATTTT
TTGAACTTGACTCCTGAAGAATACAGACCTGGTTCTTCAAGAAACAAGAAAATTGAATCA
ATTAATGTCAATCAGCATGGACTAATTGCTGCTGGTACTAATTCAGGAGAGATATTACTA
TGGCGATTAGATGTGCAAAAGTTTAAGAAACAAGATCCTAAGGCGTGTGTATGGCAAGGT
ATGGCTAGAAAACATACTAAATCTGTACATTTCTGCGAGTTCTCACCAAATGGAAAATTC
TTGTTCACAGGCTCAATAGATGGAACAGCAAAGGTCTGGAATATAGAATTAGAAAAAACC
AAAAAGGAACCCTTATTGCTTTAATTAACAGAAGAAAGACTTGTTACTACTCTTGAACAT
AGACCACCGTAAAATGAGAGAGATAAAAACACCTTTTACAGAGATAGACTTGGTAATATT
AAAAACATAGCTGAATATAAATAAAAGCAAGGTTAATGGCAAGTAGACTGCATAACTTGG
TCTTGTCATGGAAGATATGCAATTAGTGTTGTTAGTGGGAAAATGGAAATTGATAAAAAC
GATTAAGATATCAGCTTGATTAAGATTTGGGACTCCTTCACACAAAGTACAATAAATGAC
ATAGCAAAGGAGAACGGAGTCACTCTTAAAAACTATTCATTTGCTTTAGCTGCTCATCCT
AAGATAGAAGAAATATTTTTCTCTGGAAGTGACGGAGGAATTATATGTTTATGGAACATA
AAGCAAAGAAAGTTAATCAAGAAATTCATTGAATATGGTGTCTACTCGTTCGAAAAATAT
ACTATGAATGATCCATATGATGGCAAGTTTTCTCCAGATGGTTCGTGTTTTGTTGTTGGC
TCTGTCATGGGTACTTTAAGTTTGTTTTCTTGTGAATTTGCTGAATTTAAATACGAAGGT
ACAAGAGTTGAGCAGTTTTACATGAGCGACAATATTATGCACAACACTAACATTTACTAC
GATAGAGAGGTAGAACCTTAAATATGCCCTTACAGTTTGATACCTTATGAAATGTAACCA
CCATCATCCAGAATTGGAAAGTTCACAAATGAAAGAATAATGACAAATGAAGAATACGAG
AGAAATCTTGCAGTAAGATTAGAAATGGCAAGAGAAGAGGAAAACTTCATCTAAGGTTAA
TTGGAAGAGGGCTTGAGAAATGACTTCTTTAGCAATAGAGATTTATTGGGAGATTAACTT
GACTTTGAAGAGGATATGATAATAGATTAATAAAATGACAACAATAGAGGTGCTGCAAAT
AGAGGAAGGCTGAACTCTTAACTTAGCTAGATTTCTAATAATGTACAAAACCAAGGTGGC
AGTCAAGATGATGCAGAACTCCTTGAAAACTTTAATGTAAGAGGTAGAGGAAGAAGAGGA
AGAGGAGGTAATGATGCCAGAAGATCTCTTAGAGGAGGACTTAATAGAAGAGCTCAAAGA
AGAGGACAAGTTGGAGGAATGAATGGGATTGAAGAAGAAAAACAGCAAAGAAACATCAAT
CCAAATATCGATCCTGAGAACAGTTTTTATGATAGAGATAGCGATGAAAACTTCGAGATG
GAGGAGAACTTTGAAGTTAATGAATCAGAAGAAGAAGAGTCCAGTGATCATGATAGCGAT
GATTTCAATGCTCCAAAATATGAAAGGCAAAATTATCACTCAACAAGAAATGAGTAATCA
AGAGAGAATAATGAAAGAATATAAACTAGACGCCAGCAAAATCACTAGTCTACCAGATAT
TAAAGAATGCAGAGAAGATAGTAAATGACAAGATCAGAATAATAAAGTGATGATGAGAAT
GTGGGAGGTAGAAGAAATTTAAGAAGAGGAAGAAGGGCAATTCAAGATGACTCAGGAAAT
GAATCTTCTGAAAATGAAAACTTTGATATGTCTGATAATGATGAAAGTCAAAATAATAAG
CCAAAGAGAACTCTTAAGAGGGGAGCAAACAGAAAGATAGATTCAGATGAAGAAATGGGC
AAGAGTGATGATTCAGACGAGGCATCAGATTTCAGTGGAGTAAGAACTCGAAGAGCAAAA
AATAAAAACAAAAAAGAAAGATCATAACCAAGAGGCAGAACAGTCAATGAAAGGGCTGGT
AGAAATTTGAGGACAAGAGGAAATAAGAAAGTTTATGACGAAAGTGGAAGTGAAGAAGAT
TTTATGGATTATGAAGAAGAAAAAAAGCATTCTTAAGAAAATAAGCACGAAACATTAGGG
AAAAGAAGTGCACAAAGAGTTATCCAAGAAACTAGTGAATCAGAGGAGGTTGACTAAGAC
GTGATAGTTCCAGATTAAAACAAAAAGCAAAAGGGAGATGAAGATTATGAGCTAAGACCT
GAGCTAGAAGATAATAGCTAAAATAACATAGAAGAAAAGATGTGTCAATTTTGCTAAAGA
TCAGATTTACCTTTAACTGGTCCATTCTACAAAGTCAATAAGCAATCTAACGGTCCTGAT
GGGCCTCTCTATTTCCACAAAGATTGTATTGAAGTAAACAACTATTCTTTCTATCATGTT
TAAAAGCAGAAATGGATGAATATTGGTAAAGCCCTTGAAATGTTTAGTAAAAGCAGTTCA
ATGTGTAGCAGATGTGGCCTCATTGGAGGTTCAAATTACTAGTGCTTCCTTTGTAGAAAT
AAAGAAAATTACAAGTAATTTGCAGGTAAGGATCCATTAGAAAAGCAAGAATGGAAAATC
TTTAAGAAGGCAATGATGAGAGACCATTTGATATCATCTAAACAAAGCAAGTTCTTATTT
GTACCTTAAGTTAACGATCTAGTTTACTACTTTTATTAAGGCCATGAGAAATTTATTAGT
CAATACAATTGTTACTTCTATGCAGGAGACGAGCCAAAGATTAAAGAAACAGAATTTTAC
CCATGGAAAAAGTATCATGATCTTTAAAATCCCACTGTGTGCAGAATAACAAGTATCACT
TACAGATTTCCATCTAAAAATACTCTTTACTTGATTAAAAGATTTGGAAAAAGCTCAAAT
ATTACGCAAGAAAACCAAATTGTCATGCATATAGAACTAGAAATTGAAGGTGATAATAGC
AACTAATTCTCCCTTGATTTATTCCCAAATTAACTTCCAAACTTTCTCATATTAAAAAAG
CATTACTAAAATTCTATTTACATGAAACAGTAGCTTGAAGAATAAGGTAAATTTGTGGGG
GAAATCTTTTAATTAAGAACCAAAGAAAAGCAAAAGGTGAGAATAATTGCTGAGGTTGAT
AAAGAAAAAGAAGCAATTGAAAATCCTACTGGGTGGGAGTCTATATAATATAAAGTAGCT
GATAATCCAGCACTAAGAGATAGAGGTAGACGAGGCTTGAGAAGATCGGAAAATAATGAC
GATCCAATAGAGTGCATAAACTTCTGGGAACTAGTTCTCAATCAAGAATACGAAGACAAT
CTTGAAATGCAAGGACTCTCTAGCGCTTTTGATGCTGCAGAAATAGAAAGAATTTTTGAA
ATTATCTAAGACTACATTGCAAGAAATAGTGAATAGACCTCACCATTTATGGGAAGAGTT
CCTGAAAAAATTGCCCCAGATTATAGATAACATATATCTGCAGAAATGTACTTGGAATTA
GTAAAAGAGAGACTATTAAACAAATACTACAGATCTCAAGAACAATTGTTCAATGACCTT
GATTTGATATCTTACAATGCCAAATTGTACAATGGAGATGACAACCCTCTTCATAAAGAT
GCTAAGAAAATGGTAGAGAAAATAAGATGCGAAATTAAAAAGGTATTGAATTATTCTGGT
GATGCAAAAAGACAAAGATTAGAAGAAAGTAAAGGATTGCTCTAATACTTAAAACCAATT
GGAAAGCTTACTGCTCCTCCAATGAGACAAGGAGGCCCTAAATAATCATCAATGGACTAG
TTCAAAGAAAGTTTAAGGAGCAATGACTTTGAGGAAATCAAACAATAAAATCAGCAGTAT
CAATAGTACCCTCAAAATAACTTTGACAGGAACATTAGCATAGTTGAAAACAACAACATG
ATTATTCAGATTCACATACCACCAAATTTTAACATGAACAATTTATAACCAGGAAACAAT
AACTTCCAACAAAATAAATTTGATCATGAAGACAATTCAGATATGAAAATCACGCCCAAT
AATAAAATTTAAATCCAAACTGGCTACACAAGCAACCCAAATGATTCTTCCAGTTAAATG
AGAAGAACAAGAAGAAATGATAATAGCAGAAATATTAAGCCTTTTGAGGCTGAATAAATT
TAGGAAATTCCTTAATACAGTACTGGTGAAAAGCTCCCTATAAAAAGTAACAATAGCGTG
CAATTCTAAATTGGTGACTAGCCTGTAATTTAATAACCAAGTATAAGTAGCTCAGTAAAT
AATGACGAATCACAATTAGGAAAGAGAACTACTAGAAGTGGTAGACAGACAAGGTAAATG
AGAAATAACCTAAATGAAGATGCAGATGATAAGCAATTTGAAAATCTGTTAAATGGAGGA
GGACCATCAAATTAACCTTCAATTGATGGAGGAAACATTTAAACAAATAAAAGAATCAGA
TAAAACTGA


>Contig9009.0.1.g105(protein)
MDWQGETHPVKFEEAKLNFSQFDQNYLTQLLQKQTVEGGHQNKKKECAPINSKISDIKKT
KLLIGDHDNLLLRAKGLHFENFVTDQKRNLKNYQISRYQRVKTIFGHALIQEGYNAPIYN
VIFDQTGSYIISGADDGIIKIWDKETMNLQGSLHSHQEVITDMDISKCNQYLASSSKDGK
LIIWDWKKCQKLDEIAAHNAVVNNIKFYQLKLKQQGQQQREPEKVQILVTCSDDGTIKIY
DEINYINSLKQASSQTQEQQVMRRSRGRHEVQAVKKERYFLNLTPEEYRPGSSRNKKIES
INVNQHGLIAAGTNSGEILLWRLDVQKFKKQDPKACVWQGMARKHTKSVHFCEFSPNGKF
LFTGSIDGTAKVWNIELEKTKKEPLLLQLTEERLVTTLEHRPPQNERDKNTFYRDRLGNI
KNIAEYKQKQGQWQVDCITWSCHGRYAISVVSGKMEIDKNDQDISLIKIWDSFTQSTIND
IAKENGVTLKNYSFALAAHPKIEEIFFSGSDGGIICLWNIKQRKLIKKFIEYGVYSFEKY
TMNDPYDGKFSPDGSCFVVGSVMGTLSLFSCEFAEFKYEGTRVEQFYMSDNIMHNTNIYY
DREVEPQICPYSLIPYEMQPPSSRIGKFTNERIMTNEEYERNLAVRLEMAREEENFIQGQ
LEEGLRNDFFSNRDLLGDQLDFEEDMIIDQQNDNNRGAANRGRLNSQLSQISNNVQNQGG
SQDDAELLENFNVRGRGRRGRGGNDARRSLRGGLNRRAQRRGQVGGMNGIEEEKQQRNIN
PNIDPENSFYDRDSDENFEMEENFEVNESEEEESSDHDSDDFNAPKYERQNYHSTRNEQS
RENNERIQTRRQQNHQSTRYQRMQRRQQMTRSEQQSDDENVGGRRNLRRGRRAIQDDSGN
ESSENENFDMSDNDESQNNKPKRTLKRGANRKIDSDEEMGKSDDSDEASDFSGVRTRRAK
NKNKKERSQPRGRTVNERAGRNLRTRGNKKVYDESGSEEDFMDYEEEKKHSQENKHETLG
KRSAQRVIQETSESEEVDQDVIVPDQNKKQKGDEDYELRPELEDNSQNNIEEKMCQFCQR
SDLPLTGPFYKVNKQSNGPDGPLYFHKDCIEVNNYSFYHVQKQKWMNIGKALEMFSKSSS
MCSRCGLIGGSNYQCFLCRNKENYKQFAGKDPLEKQEWKIFKKAMMRDHLISSKQSKFLF
VPQVNDLVYYFYQGHEKFISQYNCYFYAGDEPKIKETEFYPWKKYHDLQNPTVCRITSIT
YRFPSKNTLYLIKRFGKSSNITQENQIVMHIELEIEGDNSNQFSLDLFPNQLPNFLILKK
HYQNSIYMKQQLEEQGKFVGEIFQLRTKEKQKVRIIAEVDKEKEAIENPTGWESIQYKVA
DNPALRDRGRRGLRRSENNDDPIECINFWELVLNQEYEDNLEMQGLSSAFDAAEIERIFE
IIQDYIARNSEQTSPFMGRVPEKIAPDYRQHISAEMYLELVKERLLNKYYRSQEQLFNDL
DLISYNAKLYNGDDNPLHKDAKKMVEKIRCEIKKVLNYSGDAKRQRLEESKGLLQYLKPI
GKLTAPPMRQGGPKQSSMDQFKESLRSNDFEEIKQQNQQYQQYPQNNFDRNISIVENNNM
IIQIHIPPNFNMNNLQPGNNNFQQNKFDHEDNSDMKITPNNKIQIQTGYTSNPNDSSSQM
RRTRRNDNSRNIKPFEAEQIQEIPQYSTGEKLPIKSNNSVQFQIGDQPVIQQPSISSSVN
NDESQLGKRTTRSGRQTRQMRNNLNEDADDKQFENLLNGGGPSNQPSIDGGNIQTNKRIR
QN