Identifiers and Description

Gene Model Identifier

Contig8764.0.1.g20

Standard Name

BROMO2

Aliases

Contig8764_0_1_g20

Description

Bromodomain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8764.0.1.g20(coding)
ATGTTGAATACATATTAAGCTGCATATATAAATTCTAAAATTTTACCAATTGGCTTCAGA
TTTGTACTTGAGGAGGAACTTGTGCAGAGGTTCTAATATTTGAGCAAAAGAAATAAAAAT
AAAAAAGGATCGACTGGGAAGGGTAGTAACAAGAAAACTAAAAATTACAATGAAGATCCA
AGTTACACATCAAAATCAAGGAGATAATCTAGTTCTGGTTAATCTGTGTCATCATCCTCC
CTAGCTGAGAGGGCGAAGTTAAAGACACTTACTTAAAAAATAATATCATCACATGCCTCC
AATAAATCGTCTAATCAAAAGAAACCATAGCAATAACCAGTTAATAAATCAAAAGTATTG
AGGGACTAATCAGATTCCAGCGATGGAGAAGATGATTTAGTAGATGATGAGAGTGAAAGT
GAGAAAAAAGGTGGCAATAACGAAGACAGTGAGGAAGAGGATGATGAGAGTTTAGTTGAC
TCAAATAGTGATAAAGATTCTGATGATGAAATAGTTAATAAGTCAAGTAAAAACAAGAAA
AAGGTTCAAGCATCCAATGGATTCAAGAAGCAAGTTCCATAGCAACAAAAAATCACTCAA
ACAATTGCTAAGAACGTGAGTAACAATCAAACTAAAATAAAGAGTGAAGTATAAAAGAAC
TGCCTGAAAATAGTAAATTTGTTAAAAAAGGAAGATCGATTTCACAATATTCCAGCATTT
CTTGATAGATTCTCTAATATTGAGAAGAAAATTGCTTCCTAGTAATACACGAGTTTAAGT
TAGTTTAAAACAGAAATGATTGGCTCTTTCAATTAATTAATTCAGATAAATAGTGGAAAT
ACAGACCTCATTAATCTTTGTTAAGAAGCCTTAAAGAAATTCGATACAATTTATGATGTT
CTTACTTGCGATTAAAACCTCTCTTAAAATGCTACTGAGACTCATTCGTAAAGTTAACTT
AAACACTTGGAGAAAACTGTGCAAAGTCTAACCAAAAACTCAAAGGGTTAATTTAGCAGT
AAAAATGGGACTACTAAAAATGATGGCAGTTGTGTTCCACCTCAAAGTATATCAAGAAGT
AAAAAGACACAAGGCCCCGATGCCCTTATGACAACTGAAGAATAAACAGCATTAACATAA
TTGATTGGGACTTTGAAAGCTGAAGATTAAATTGGCATTTATGAAATAATTAAGAATGGT
CCAGGCGTGGAGGTAGTAAACGGTGAGCTACAATTTAGTATATCAAGCTTACCAGCAATT
ACTTAAAGAAATTTGGAGCGATATGTGAAAGGTAAACTTTAAAAAAGCAGGCCCAAGAAA
AAGCCAAACTTGAATCAACCAGTGTAAAATAACATGAATCCATAGAACATGAATCCATAG
TAAAATAACTTAAATCGCTAATTTCCCTAACCATAATTACCTCCTCCAAGGTAAACAGCA
TAAGCTTTGATGTAGCCATATAGAAACTTCTAAAATTAATAGCCTTCAAGCAATTTTCCT
ATAAATCCTCCGATACCTAATAACAATCCACAAGATTTAAGCAAGAAAATCTTGAGTGAT
AGTGACAGCGATAGCGACTCTTCCGATAGCTCAGACGATGAAAATCTAAAGCGAGGTCTT
TAGACTACAGACACTTCTTTCAACCCAAATTCCATAACTGCAGCAAACAGTAGCATAAAT
CCATAGCTGCAAAATAATATACAAAATGCCTCAAACAATAACTAATATTAAAGTAGAAGC
TTTCATGATATTTGGAGAAGGAATGTTTAGCAATAATAATAATAATAGCTATAAAATTAG
TAAATGTAACAATAACAATCAAATAATAGTAGTACTAATAATGCTACATGA


>Contig8764.0.1.g20(protein)
MLNTYQAAYINSKILPIGFRFVLEEELVQRFQYLSKRNKNKKGSTGKGSNKKTKNYNEDP
SYTSKSRRQSSSGQSVSSSSLAERAKLKTLTQKIISSHASNKSSNQKKPQQQPVNKSKVL
RDQSDSSDGEDDLVDDESESEKKGGNNEDSEEEDDESLVDSNSDKDSDDEIVNKSSKNKK
KVQASNGFKKQVPQQQKITQTIAKNVSNNQTKIKSEVQKNCLKIVNLLKKEDRFHNIPAF
LDRFSNIEKKIASQQYTSLSQFKTEMIGSFNQLIQINSGNTDLINLCQEALKKFDTIYDV
LTCDQNLSQNATETHSQSQLKHLEKTVQSLTKNSKGQFSSKNGTTKNDGSCVPPQSISRS
KKTQGPDALMTTEEQTALTQLIGTLKAEDQIGIYEIIKNGPGVEVVNGELQFSISSLPAI
TQRNLERYVKGKLQKSRPKKKPNLNQPVQNNMNPQNMNPQQNNLNRQFPQPQLPPPRQTA
QALMQPYRNFQNQQPSSNFPINPPIPNNNPQDLSKKILSDSDSDSDSSDSSDDENLKRGL
QTTDTSFNPNSITAANSSINPQLQNNIQNASNNNQYQSRSFHDIWRRNVQQQQQQQLQNQ
QMQQQQSNNSSTNNAT