Identifiers and Description

Gene Model Identifier

Contig917.1.g108

Standard Name

BROMO1a

Aliases

Contig917_1_g108

Description

Bromodomain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004995300.0000000000499999055251093Bromodomain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig917.1.g108(coding)
ATGTCAGATCATCCGCAATATTAACCATAAGGAGTGAGCACTCACATCCCTCACTAGAGC
TAACAATCTCAAGAGCATCCAAATCAGCAGATCAATTAATTCCCTTATTAGTAACCAGTT
GATATTCCTCAAAAGATTAATGTTTACCACAATTAGCAACTCAATCAGCAGATGAATGAT
GATACTCATTAGACATCAAGAATGGAAGATTCAAGATTTAACTAAGGAGATAGTGAATAT
AATGCCAATAATGAGTCAAATATTATCAATCAGACTAATCCTTATGCTCAGTAACATCAA
GTTCTTTAGCATAATCAAATCTAACCACCTCATCTTCAACAATTACCAATGCAAAAGGCA
CCAAGCAATGGACCTCTAACTAATTAACAGTAATATGCTGGACCTGGACAAACTGGGCCT
TAGGGTGAAATCCACAGCTAAGGAGGTGTTAGTGGACCTGCTCCTCATCAAATGATGAAT
CCAGTTGGCGAAGAAGGGCATAACTTTCATCATTAGCAACCATAACCAAACTAAAATGCT
CCAATTCAACTCTAATAACATCAACCTCAACCAGCTCAATAATAAATGTACTAAGGGTAC
CATCCAAATATGCCACCTCAACCTCAGTATCAACATTAACCACCCTAACAACAGTTTTAG
TATGGCTAACAACACGGTGCTATTAATCCAAATATGAATGGACCTCCTCATTTGGTATAA
AACTAAATCCCTCAACAGTAATATCCTGTCTAAAATAACATTCCAGGTTATTCTTAAGGT
TATGTGCAGTAAAATTATCCTCCTTAACACATGCACTAACAACCTCAACCTTAATTCACG
AATTAGCCAGATTAAATTATGCAATCCCCATTTTAGACCTAGAATTAACCTTAAGTTCAT
TCACAGTAGCACTAACCAATTCAAAACTTCTAACATGACCAAATTGCAATGACTTAAAAT
CCACCTTAACCAATAGTAAGCTCTCCAGTAACCCAGGAAAAGCAACCAAGCAGCTAAAAT
GTTTTAGCTCATAATATTAGTTTTGGTTAGGCACCTCCTCCATAATAGCAATAACAATAA
ATTCATCCCCATTAGTAAGTTCACCCTTAAATCTAAGGTCATCAGCAATAGTTGCATCAC
TAATAAATCCCACAAGCTACCCCTACTATGCAACAATAATTGCATAATATACCCTAGTAA
TAGATGAATTTCAATAATCCAAATCCTAATTAAGCTCATATTATGAGAGGTGCTGAAAAT
CTATCACAAACTTCTGTTAATTAAAATATGGGAAGTAACACCAATCTTTAAAACATTGGC
CATATGGGAGGTATGAAGCAAGAGGAATCAAAAAATCACAGTAGAGTTGAATCAAGCTAA
AATTTAAATGGTCTTGGAGATCACACTTTCAACAATGAGGCAAATGCTAATACAAACGGA
AATATGAACTCACCAAAGGCTTAAGGAAAAGAAGTGGGATTTGTCACAGCTAATATCTAT
TAGTCAGCTACTTTGAACAAACTCTTGCCAAGAGGATTTAAGATTGAATTGACAGAGGCA
GTTCAGAGAAATCATCAACAAAGATTAGCTTAGCTATTGTAAAAAAAGAATGCTGCCGCT
GCTGCTTAAAAGAAAAAGAAGTCAGTTCCACCTCCTTAAATTATTCCACAATATGTTCCA
CTTACTAAGCAACCAAGTAAGCTGAATGAAAATTCAATGGGAGCGTCAGAGTTGGCTGAT
AGTGATGAACTTCATGCATTGAATAAGTCTGGACAAAGAATTTCAGCAAGAGAAAAAAGA
CCAGTGAACTATAATAGTATGGCAGCTGGCACCGGGGAAATAAGTGCTAGTATGGATTAC
GGGGAAGTTAGCGGACAAAATCAAAGAGCAGTTTAGAAAAAGCCTGGAAATCTTAACAAT
CCAAAGGAAGTTAAATAAAGATGCGAGACCCTATTCTAAACACTTAAATGTCATCCAAGC
ATTTCTTTGTTCCTCTCTCCACTTGAAATAAGCCACCCAAGATTTGCTGAGATTCAACCA
GATTTCATAAACTTGCACAAGATTGAATTAAACTTTTAATAAGGGAAATACAACTCTACT
TTCAATCTCGGCAACGACTTTAGAAAGATGTGGCAAGTAGGACTCAAGCTCTACGCAGAA
GACCCAATAAAAATCAACAAAATTCATGAAATTCAGATATACTTTGATCAAATCTTCCAA
GAACTTGAGAACAAACCTCTCCCTACTCAGCCAGCAACCTAATTCTAAACTATTGAAACA
CATCCTCCAATTCAATAAGCACCAAAGAGTAATGCCTAATAAATGAGCAAGAAAATTGAG
AAGATCCAAAAAGAGCTTCAATAAATGAAAGACAAAACTTCATCATAGGCTTAGTCTACC
AAAAATTAAAGAACAATCAATCAGATTCAAAATACTATTCATGCTGCTCAGCAATCAAAC
TTAAGTGATAAGCCCATGACTCCTCAAGAAAAATCAATCTTAAAAGATTTCATTGGTCAA
TTAACCCCAGAGCAATAAAGAGGCATCATTGAAATTGTTGCAGATATTGTCGGTCAGAAT
AATTCAGATATCTTTGAATTTGAGCTCGATAGCCTCCCCAACAGAAAATGCAGAGAGCTT
GATGTCTATGTGAGAAAATGTATGTCCTTAAACCAAAAGAAATAAAAAAGAAAGGAAGCA
GATGCTTTGAGAAGACAACAGTAAAAAGCGATGGCACAAAAACCTTCTGGTCAGTAAATG
TCCCAATAAAATATTCAGCCTCTTTAACAGCAGATGTCACAACAATATCCAGGCCAAATG
ACAGGTGTGCCTATGGGATAAGCTATGCAGCAGCAAATTCCACCCTAATAGCAATACATG
CAGCAAATGCAGCCGATGCAATAACAACCCTTGGCTCATTAAATGCCAGGCTAAATGGTA
CCTTAAACTGGTTAAGTTATAAATCCAATGGTTCAAGGTCAACCTCAAGCCCAAGCTATG
ATGGGCGGAGTTCCAGGCTAGATGATGCACTAGCAACACATGCCTCCTCAACAGTAAATT
CCAGGCCAAGTACCCCAATAATACTAGATGATGGGGTAAGCACCAGTAGGAGGGGCAGTT
GGAACTGCAGGTGGTCATCCTCAAGCTCAGTAAGCTCCCATAAACTAAAACTTCTAGTAT
GGTCGCAGAGAGAACTTAAATGACATAAACGATAGTGAATCTGATTCAGACAGCGATGAC
AGTGATTCTGACGATGACAATATTAAGAAGGGCGGGAACTAACCAGCTCCTTCAAACAAT
ATTTCACAACTCTGGAGAAAGCAACAACAAAATAATTGA


>Contig917.1.g108(protein)
MSDHPQYQPQGVSTHIPHQSQQSQEHPNQQINQFPYQQPVDIPQKINVYHNQQLNQQMND
DTHQTSRMEDSRFNQGDSEYNANNESNIINQTNPYAQQHQVLQHNQIQPPHLQQLPMQKA
PSNGPLTNQQQYAGPGQTGPQGEIHSQGGVSGPAPHQMMNPVGEEGHNFHHQQPQPNQNA
PIQLQQHQPQPAQQQMYQGYHPNMPPQPQYQHQPPQQQFQYGQQHGAINPNMNGPPHLVQ
NQIPQQQYPVQNNIPGYSQGYVQQNYPPQHMHQQPQPQFTNQPDQIMQSPFQTQNQPQVH
SQQHQPIQNFQHDQIAMTQNPPQPIVSSPVTQEKQPSSQNVLAHNISFGQAPPPQQQQQQ
IHPHQQVHPQIQGHQQQLHHQQIPQATPTMQQQLHNIPQQQMNFNNPNPNQAHIMRGAEN
LSQTSVNQNMGSNTNLQNIGHMGGMKQEESKNHSRVESSQNLNGLGDHTFNNEANANTNG
NMNSPKAQGKEVGFVTANIYQSATLNKLLPRGFKIELTEAVQRNHQQRLAQLLQKKNAAA
AAQKKKKSVPPPQIIPQYVPLTKQPSKLNENSMGASELADSDELHALNKSGQRISAREKR
PVNYNSMAAGTGEISASMDYGEVSGQNQRAVQKKPGNLNNPKEVKQRCETLFQTLKCHPS
ISLFLSPLEISHPRFAEIQPDFINLHKIELNFQQGKYNSTFNLGNDFRKMWQVGLKLYAE
DPIKINKIHEIQIYFDQIFQELENKPLPTQPATQFQTIETHPPIQQAPKSNAQQMSKKIE
KIQKELQQMKDKTSSQAQSTKNQRTINQIQNTIHAAQQSNLSDKPMTPQEKSILKDFIGQ
LTPEQQRGIIEIVADIVGQNNSDIFEFELDSLPNRKCRELDVYVRKCMSLNQKKQKRKEA
DALRRQQQKAMAQKPSGQQMSQQNIQPLQQQMSQQYPGQMTGVPMGQAMQQQIPPQQQYM
QQMQPMQQQPLAHQMPGQMVPQTGQVINPMVQGQPQAQAMMGGVPGQMMHQQHMPPQQQI
PGQVPQQYQMMGQAPVGGAVGTAGGHPQAQQAPINQNFQYGRRENLNDINDSESDSDSDD
SDSDDDNIKKGGNQPAPSNNISQLWRKQQQNN