Identifiers and Description

Gene Model Identifier

Contig18145.0.g34

Standard Name

BRN1

Aliases

Contig18145_0_g34

Description

Condensin complex subunit 2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005546005.997739233660418e-28hypothetical protein
SGDYBL097W0.000000000003001226732525078BRN1 SGDID:S000000193, Chr II
from 40831-43095, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18145.0.g34(coding)
ATGAAAGTCGGTTAAATTTAGTAACTACCTCAAGCCCCCAATAACTTCTTGTCAACCTAT
GATAATACTTAAATGCGTAACAATCAAATCATCGAGCCTCCTTAAACTTCAGAATAGATA
GTAAATGCCAAGAATGCTTTCGATTTTGATATTGATTTCGTGCAAAATTTAAGCTTACTT
CTAAGCGACAAAATTGACAATGAATCTTAATGGCTTAGAGCAAGTGCTTCACTTGATGCA
GGAACTAAGATATATGCCTATAGAGTGGATTAAGTGCATTAGGAAACTTACAAAATATTA
GGAGGACTGCACAGGCAAGAGCAGGCAGCCAGAAATACTAGTGAGGCTAGCACATGTGGA
TCATTAAATGGAGGAGACCAGGAGTTATTCACAATGCTCAATGGTCTAGCTGATTAAGAC
TCATCAATAATTTAAAATAGCAAAAAGAACAATAAAAAACCATAGCAAAGCATTTAATTT
ACAGGCGGTGAGAGGACCCTTGAAAAAGATCCTAAAAATCTTGATGTGACTCGCTTTGAT
ATAGAGGCAGAGATCGATCCTTTATTCAGATAAAGAACAGCAAGATTTGATGAAAGTGGA
GCAAGAAATTTGCTAATAAACATCACGCACGTCGACAAAGGTCTTAACATATAACTTGAT
TCAGAAATTGCTGAGGTTAACAGGCAAAAACTTTTCAAGCCATTTAAAAGAAAGCAAGAT
AAGTCTATTGAGGAAGTTGAACTAGAATAGATGGAACAATTCAAAGTTCAAAAATGGAAT
TAAGAATATATGCTTCTCTGCAAATCTGTTTTTAAAGCTGAAGGTGTTGACACATTATGC
GGGTAGAGAATGTCAAGAGAATTAGATATGAAGAGAAAAGAAATTTACGATTACATGGGA
GGGGTAAGAGTGAAACAAAAGAGAAATAGAGATTAACATGAATAAATGTCAAATATCAGT
GAAATGAGTCTTATTCAATCAGAAATGATGACTGAAATGGACGAGCTTGATAAATTCATT
CAAGAAGTTATTGAGAAAAATGACTAGAAAGTTGTTTAAACTCCAATTTAACCACCTTAA
ATAAATGCAACAACAATTAGACATGAACCAAGACAACAATAAGTGCATCATGAAGGAATA
TTTTTAGCAGGAGATTTTGAGAGTTAAACAATGAGTCATTCAAGATACCTTGACCCTTTT
CAGTAAAACAACATGTCTGAATAAAACACTATGAATTAGTAAAATCACTATGACGAAGAT
TTTGTCTAAGCTCAGCAGGAAAATGATCAAGAGTTCTTTAATCAAGGAAATTAAATGAGA
CAAGATTCACATATTCAAAGTGACTATGGTGAACCAGGTGGAAACGATTATGATAATGAG
GAAGATAGAATTCATGATGAAATTCAAAATGAAATCCAGCTAGAGCAAATGGAAGATCAA
GCTGAAATGAGTCTCTTTGAGAAAGCAGTTATTAATACCGATCCTATTACAGCAGAAGAA
TTGAAAAATTAAAATAAGAGATTAACAGAAGAGAAGATTGATAAAAGTAGAATAAGCGAC
TTAAAAGATGCTTAAAAATTGCTTATGATAGATGGAAGATTCAAAATGAATAATTAACTT
GGTACTGGTAATTAAAAAGTGTTTGATGATATGAGAAAATCACTCGCAACTGGGGATGGA
GATAGTGTTTTAGATTAAGATCTACTTAGGAGAGACAAGTAAAAGAGAGAAATAAAAAAA
AGAATGATAGACGATGAGGTGCTTCAGTCTTACGATAAAATTTAGCCAAGTATGGATACA
TCTCATAAATCAAATAAAGATAAAAAGAATTCTACTTAACCATCTTAAGCCTAAAAATCG
GCTTAAAATGCAGGTCATGCTCTTGAAAAATATATTAAGGAAACTCGTATTAAAGATATT
AAACCGCAGCATTTAACAAGATTTGAATCTAAAGATATTTCAAATTTAGCTACTAGAAGC
TTGCCAAAATTCAATTTATAGTTTTATGAGACTCACCCCCTTAAAAGATTATCAAGATTA
TTCTGTAGAACTTCATGGATGAAAATATCTGAGATAGATCCTGCTAATATTGATTATCAC
AGCATTTAAAATCTAAATTTCTAGGAAGGTGCTCATGGCAACATGGAACAATCTGATTTA
CAGAAATCACAATTCACTAACAATTAAAGCACCTTCGACTTGAAACTTTATGAATAATAT
TTGGGTGTTAGTGGTCCCTCAATTTAAGAGGAGCTTAATAATCCCAATTTGACACTTTTA
AACCCTGAAGATGCTGGGAGCTAAATTAGCTCATGCAGTTACAGCTATTAAAAGCCTCTA
TAGGAAATGTCAAACTACTCTCACGGAGGATCTATAAATAATAATGAGCTCTCGCATATT
TCTTTTATTCAAGAAAGCACTAACAGAGTCATGAGCACTCTAAATGATAATGGTAAAGAA
ATTAATGGTGATTATTTAAGTGAATTAGTTCCACATAGAAAGCATTAAAATTTGCAGCTG
CTCATTCAAGATTTCTCCATCAATTAAATCGGTGGAAATTAAGATAAAATAGTTAATGCC
AATTTAGACCCTGAGACTCAACCTCAAAAGAGAAAACTAAAATTATTCTAACATATTTTA
GATAAACATGATGAACAAGAACAAGCATAACTCGAAACTGAATAATAATTGATGAATCGT
ATCTTATAAGCGAAGAAGTTTGACATTAAGCTTTTGAAGGAAGAAATTTGGAAAATGCTT
GAAAATTAAATCCCTAGACTAGACCATAGAACACAACGTAAAATAGAAAATAGATAAATT
GGGGTGAATCTTGTTGAAGAATTAGTACCCTAAGACCCTTAAAATGATTTGAGTTTTGTG
GATTTAATTGAAGCAATCCCTATGAATTGCTCTGAAAATTAAGATCTAATTACAACTCTT
TCAATTCACACGACCTTTGTATGTTTGTTACACTTAGCCAACGAGCACAGACTCTAACTA
AAGCAAATAGTTAAAAATGCTAATGGAATAGTGAATAGTAATTTGATATCAAACACTACA
CCAAACAACAAACATCAACCAAATCAAGCTCTATTTAATAATTAAGCTCAAACCAGTCAC
TTCTCATAAATGGGTATGGGCATGGATCCACAATCATATATGTCAACGAACAATAACATG
AATAGCTATAATTATAATAATATAAATGGAAATGCTAATGTTCCAGGTTATTAGATTATT
CCTTATAATAACCCACAAGGTGGACAGGGTTCGGTTGCATCAAATGTGCTACAATTGGGA
GACTTTTTCGAAGATTTCAATTTATATGCGGAGGTACTTTAATAATGA


>Contig18145.0.g34(protein)
MKVGQIQQLPQAPNNFLSTYDNTQMRNNQIIEPPQTSEQIVNAKNAFDFDIDFVQNLSLL
LSDKIDNESQWLRASASLDAGTKIYAYRVDQVHQETYKILGGLHRQEQAARNTSEASTCG
SLNGGDQELFTMLNGLADQDSSIIQNSKKNNKKPQQSIQFTGGERTLEKDPKNLDVTRFD
IEAEIDPLFRQRTARFDESGARNLLINITHVDKGLNIQLDSEIAEVNRQKLFKPFKRKQD
KSIEEVELEQMEQFKVQKWNQEYMLLCKSVFKAEGVDTLCGQRMSRELDMKRKEIYDYMG
GVRVKQKRNRDQHEQMSNISEMSLIQSEMMTEMDELDKFIQEVIEKNDQKVVQTPIQPPQ
INATTIRHEPRQQQVHHEGIFLAGDFESQTMSHSRYLDPFQQNNMSEQNTMNQQNHYDED
FVQAQQENDQEFFNQGNQMRQDSHIQSDYGEPGGNDYDNEEDRIHDEIQNEIQLEQMEDQ
AEMSLFEKAVINTDPITAEELKNQNKRLTEEKIDKSRISDLKDAQKLLMIDGRFKMNNQL
GTGNQKVFDDMRKSLATGDGDSVLDQDLLRRDKQKREIKKRMIDDEVLQSYDKIQPSMDT
SHKSNKDKKNSTQPSQAQKSAQNAGHALEKYIKETRIKDIKPQHLTRFESKDISNLATRS
LPKFNLQFYETHPLKRLSRLFCRTSWMKISEIDPANIDYHSIQNLNFQEGAHGNMEQSDL
QKSQFTNNQSTFDLKLYEQYLGVSGPSIQEELNNPNLTLLNPEDAGSQISSCSYSYQKPL
QEMSNYSHGGSINNNELSHISFIQESTNRVMSTLNDNGKEINGDYLSELVPHRKHQNLQL
LIQDFSINQIGGNQDKIVNANLDPETQPQKRKLKLFQHILDKHDEQEQAQLETEQQLMNR
ILQAKKFDIKLLKEEIWKMLENQIPRLDHRTQRKIENRQIGVNLVEELVPQDPQNDLSFV
DLIEAIPMNCSENQDLITTLSIHTTFVCLLHLANEHRLQLKQIVKNANGIVNSNLISNTT
PNNKHQPNQALFNNQAQTSHFSQMGMGMDPQSYMSTNNNMNSYNYNNINGNANVPGYQII
PYNNPQGGQGSVASNVLQLGDFFEDFNLYAEVLQQ