Identifiers and Description

Gene Model Identifier

Contig21284.0.g17

Standard Name

BRIX1

Aliases

Contig21284_0_g17

Description

Brix domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004300602.999564368270328e-76Brix domain containing protein
SGDYOL077C2.999564368270328e-76BRX1 SGDID:S000005437, Chr XV
from 186723-185848, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21284.0.g17(coding)
ATGTCATCAGCTTTCAAAAAGGCACAAAAACTTGAGAGTTTAACTAAGTCTAAATTCGAT
GAGGATCTAGATGAGAAATCAAACAAGAACCTTATAGATTTAAGTGATGATTCATCAGAT
GAGGAGAATAATGGTAAAGCCTAAGTAGATTCATCAGATGAAGAAATTGAGATAAAATAA
TCTAAAAATGGCATCAAAAAGATTACCAAGGCTAATCTAGAGAAGAAAGTCAAGGACCAA
ATTAAACAAGATAAGTCTGGTGAATTGAGTGTATTCAAGGATCAAGATGCAGATAGCAAA
GAATGGAAGAATCGTCAGAGAACTTTAGTGCTTTGCGCCAGAGGTGTCAATTCTAGGTTC
AGACATTTAATGAGTGACATGATTGACTTGTTGCCCTAGGGAAAGAAGGAAAATAAAGTT
GAGAGAAAGATTGCTAAGGATGTCATAGATGAGTTGTGCTTCCAGAGATCTTGCAACAAT
TGCATCTACTTCGAATAGAGAAAGAAGAGTGACTACTTTTTATGGTTGATGAAGTCACCA
AATGGACCCAGCATCAAATTCGCAGTACAAAATATTCATACATCCGATGAGCTTAAGCTT
ACTGGAAATTGCTTGAAATACAGCAGACCCATCGTTTCATTTGATTAGAGCTTTGATACT
ACTCCTTTCTTGCAAATGACAAAAGAGATGCTAACTTAGGCATTTACTACACCTAAAAAT
CACCCAAAGAGCAAGCCATTTATCGACCACGTGATATCATTTTCTTACTATGATGGCCGT
GTTTGGTTCAGAAACTACTAAGTCGTTAATTAACATGAGGAGAAGTTTACTGAGAAAGAT
GATATTGAAAAGTTAATGCTTATTGAAATCGGACCTAGATTCTGTCTTTAGCCAATTAAA
GCCTTCGACGGCACTATGGGAGGGGAAGCTCTATGGCAAAACCCAACCTACATCACCCCC
TCAAAGCTCAGATCCCGCAAATTCGAGCAATTTGTTAAGAGAAGAGAGCAAAAAGAGGGC
AGAAAAACATACAAGAACGTAATCTAAAAGGGAGGTCAAGACCCAGACGGATATCTTCAG
GATGCCTTTATTTGA


>Contig21284.0.g17(protein)
MSSAFKKAQKLESLTKSKFDEDLDEKSNKNLIDLSDDSSDEENNGKAQVDSSDEEIEIKQ
SKNGIKKITKANLEKKVKDQIKQDKSGELSVFKDQDADSKEWKNRQRTLVLCARGVNSRF
RHLMSDMIDLLPQGKKENKVERKIAKDVIDELCFQRSCNNCIYFEQRKKSDYFLWLMKSP
NGPSIKFAVQNIHTSDELKLTGNCLKYSRPIVSFDQSFDTTPFLQMTKEMLTQAFTTPKN
HPKSKPFIDHVISFSYYDGRVWFRNYQVVNQHEEKFTEKDDIEKLMLIEIGPRFCLQPIK
AFDGTMGGEALWQNPTYITPSKLRSRKFEQFVKRREQKEGRKTYKNVIQKGGQDPDGYLQ
DAFI