Identifiers and Description

Gene Model Identifier

Contig22668.0.g8

Standard Name

BRE1

Aliases

Contig22668_0_g8

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007905300.0000009995106777214876zinc finger protein
SGDYDL074C0.0002999184360822198BRE1 SGDID:S000002232, Chr IV
from 326149-324047, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22668.0.g8(coding)
ATGAGTGATTCACGAAACCTTAAAAAGGGCGGTATGGAGCCCATGTTGAGTGAAACTATG
ATGGATACCAACAGTGTGATGTAGTACTAAAACAAGGCTTTAGCAAGTCTTTGTATAAAT
TACAAGCAAGAAATTGCCAATATGAGAAATATTATATAAAATTAAGAAAAAGAGGCAGAG
TTGTGGAACAAATCTTTCTCCAACTTCGCACTTGCTCTGCAAAAGGCAAACAATGAAATC
GGCAGCTTACTTGCTTAGCAAGCTTCTCAAGCAGGAGTTTAAGCTAAAGATTTGGAGAGC
GACCCATTAAAGTTGCAGTAGTATATAGTAGATAAGCAGTCGTCCTTATACAAAAATCTA
ATAAACTTAATTTTTCTGCCAAATTAAATCTATGAGTCTTCTTCTTCACTCTCCCATCAA
GAAATGGAAGATATCTCAACTTCTCAAATCCAAACTTCATCTTAACAAATGAAGCAAGGT
GGAGAAGAAGAATCTAAAATTTCTGCCGGGGAGATGAAGTTGAAAGATGCTTCAGAAAGT
CTCAACCAGGCTTTTGTCTCCGCCATGTAAAGATATATCTAAGTACTCAGACTCTCTGAG
CTTTAAGGTATCTTACTATTATTAATTAATTCATACTAGTTTTAAGGTAACAAAGAGGTT
GGTCAACTCAACTAATCCAACCAGCACCTTAATCAGCAGTCACATGAGAACTTGCTCTCC
TAACTTTCCTAGTTGAAGCAAAAAACAGATGAGTTGAATCGAAGAATCTCTGAAAAGAAC
GCCTATATGGCTCGTCTTGAAGAGCAGAAAAAGGAACTTGACACTCAAAATTCAAGTTTA
CTATCTCGAATCAACTCCATCTAAAAGGAACTCAAGAAGAGTAAAGAGCAAGTTGAAAGA
ATTAACCTCAGAACCATCAGAGGAGCTCCTTATATACAAATAATCCAAGAATTCTTCCCT
GATCAAGTCTCAAAGTTCGTTGAGCCTAACCATACTTGTGTGTGTTCATAATGCTTGAAA
GAGCTAAATCAAAATTTGCTTGTTCCACAAAGCTCAACCGAGCAATCCTCTGTCCCTAAT
CAGCTTGAAGAATAGAAAAACGACAATTCGATGCCTTCACACAACAATGATATCAAATCA
AGTGCCTCAAAAGGTGGAGAGACCTCGAAAGTTGACTAAGCTCTTTTAAACGAAAGAGAT
GAAAAGATTGCTGATCTCGAAAATACACTTACTTCTTTGAAAATTCAAAACAAAGAACTT
TTCAGTCGTATTGATAAGATGAAATCCCAAGCCGAAATATCAGAGGATAAGTTTTCCAAT
ACTCAACTGTACAAACTACTTGTAACATAGTGCTAATCACTAGCAGAGCAACTTTCTAAG
CATCAATAAGACGCTTAGAAGTTCAGAGACTTGAAAGGCACCTATCAATCTGTAAAATCA
CAGAAAGATTTGCTTGAGAGCTAACAAAAAGCTGAAATTAAAAAGCTTTCAGATCAAAAT
GAAAGTCTGAAGAAGTAAGTTAGTGACCTGTAATAGACTAATTTCAAGCAGCTCTCTCAA
ATTCAAAACTTGAACGATGAACTCGGCAGGATTTCCTCTGAGACCTCACAATTGAAGACT
ACCCAGTCAATTGAGCAACAGACTGCTGCCATGATCTCCCAACAGAACAAGACTTTGCTG
GACAGCACCCAGAGAGCCGAGAAATTAGAGAAGGAGATTGCTGAACTGAGAAAGAAACTG
GATGACTACAAGAGAGCTTACAACGAACAGAAAGCTAACCTGTAGAAAGCTACTGCTGAT
GTTGAGAAGCTCAAAAATCCAAGTGCTGCCCCTCAAACTAATGAGAAAGAACTGCAAGAG
AAGTATGAACATGCCAAACTTAAAATCAAAAAACTAGAGGACTAGAAACGAGAACTTGAG
AAGAAAGTTGGCCCACTAGAAGCTAAGATCTCTGAGTAGCAGTCTAACATAGATGCACTC
TATCAGGAAGTACAGTAAGTCTATGAAAGCCAGGAGCAATCAGTTTCTGAGTAGACCAAG
CTGGCTGCTTAAGTCAAGTCACTCACTGAGAAAGTTGGCTTACTACAGAATCAAGAGATG
ACTATCAAACTTGAACTGCAGATGAAAACCAGTGATCTTGAGAAACAAGAAACTCGCTCT
AGAATCCAAGATGAGCAACTTGTTGATTTAAGGGACCGCTAGAAGCTTGACTCTGACATA
GTAGAAAGCCAAAAGGCTATGATTTCAAACCTAGAGAAAATCCATCAAGCTTAACAGGAA
GCACTTCACGATGCCATTCAAGAGATGAATGAAGCAATCAAAAAGGAGAAGGCTTCCACT
GATCGTGCTCTCTAGATGTAGAAAGTGATTGATGATCTTTCTCAAAAACTTATGATCGTC
AGCACTGAATCTGACTAATATCAAATCAAACTGCAGGAAATAAGGAAGAACCCTTACAAT
TAACTACAAGGTAGTGGCCCAGCCACCTGTGATGAGAACGATATCCTGTTCTTGAGAATG
AAAGCTAAGAAGTATGATTCCCGCATGAAATGCCCATGCTGTAACACTCGTGAGAAGCAG
GTCATCCTCCCATGCCTCCACATGTACTGCGATGAATGCATCCAAAATCAGCTGCAAGCT
AGAAACAGATGCTGCCCCGTGGATAGACAGAAGTTCCAGTCTAGTGATGTCAAGAAAATC
ATCTGGGGAGAGAGTGATGTTTGA


>Contig22668.0.g8(protein)
MSDSRNLKKGGMEPMLSETMMDTNSVMQYQNKALASLCINYKQEIANMRNIIQNQEKEAE
LWNKSFSNFALALQKANNEIGSLLAQQASQAGVQAKDLESDPLKLQQYIVDKQSSLYKNL
INLIFLPNQIYESSSSLSHQEMEDISTSQIQTSSQQMKQGGEEESKISAGEMKLKDASES
LNQAFVSAMQRYIQVLRLSELQGILLLLINSYQFQGNKEVGQLNQSNQHLNQQSHENLLS
QLSQLKQKTDELNRRISEKNAYMARLEEQKKELDTQNSSLLSRINSIQKELKKSKEQVER
INLRTIRGAPYIQIIQEFFPDQVSKFVEPNHTCVCSQCLKELNQNLLVPQSSTEQSSVPN
QLEEQKNDNSMPSHNNDIKSSASKGGETSKVDQALLNERDEKIADLENTLTSLKIQNKEL
FSRIDKMKSQAEISEDKFSNTQLYKLLVTQCQSLAEQLSKHQQDAQKFRDLKGTYQSVKS
QKDLLESQQKAEIKKLSDQNESLKKQVSDLQQTNFKQLSQIQNLNDELGRISSETSQLKT
TQSIEQQTAAMISQQNKTLLDSTQRAEKLEKEIAELRKKLDDYKRAYNEQKANLQKATAD
VEKLKNPSAAPQTNEKELQEKYEHAKLKIKKLEDQKRELEKKVGPLEAKISEQQSNIDAL
YQEVQQVYESQEQSVSEQTKLAAQVKSLTEKVGLLQNQEMTIKLELQMKTSDLEKQETRS
RIQDEQLVDLRDRQKLDSDIVESQKAMISNLEKIHQAQQEALHDAIQEMNEAIKKEKAST
DRALQMQKVIDDLSQKLMIVSTESDQYQIKLQEIRKNPYNQLQGSGPATCDENDILFLRM
KAKKYDSRMKCPCCNTREKQVILPCLHMYCDECIQNQLQARNRCCPVDRQKFQSSDVKKI
IWGESDV