Identifiers and Description

Gene Model Identifier

Contig21371.0.g39

Standard Name

BRD3b

Aliases

Contig21371_0_g39

Description

Ankyrin repeats (3 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000731701.9997255150861791e-53Bromodomain containing protein
SGDYGR252W2.000769134519826e-18GCN5 SGDID:S000003484, Chr VII
from 996869-998188, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21371.0.g39(coding)
ATGGATCAAGAAAAGCAGCAAAATGTCAATTAAGCCCCTTTTGATGGCTAATAATTTCAA
ACTAATCATCATTAAGCTCAATTCTAACAGCATTTGAATTAGTATGAATAACCCTAACCC
TAATAGCAAGCTACTGTAGAGTTTGAGCAAACATATCAGACCTAAACACCCTCTGGAGAC
CAAATAATGCAGGTTTAATATCAATCTCAAGTGCATGTTGAAAAGCAAGAAAGCAGTAAT
TCTGCTCATTCTCCTTTTCAAAACACGCAACCCTCTCCAAATGTTGTATAAAAAACTGTT
GCAGGGGTTTATTACTAATAAAATAACTACCCTCCTCATTAGGAAGCAGAAGAAGGGCAC
TCGAAGTCGTTATAGCAGGAAATAACATAAGTTTAAGGAGGTAATCAGCAGGTCATTTAA
CAGCAGCAACATTAAGAAACATAGTAGTATTCTGATGGCAATTCCGCATAACTTTTTGTG
GGTTAACAATTCATGCAATCTGCTTCGCCTGCAATTGATATAGAGTAGAGTATGTAAAAT
TAGCCTCTTAGTTTGAACGAGACACCATCATTTAGGCCTGACTTTTAAAACTAATTTACA
TAACAGTAGCAGGCAGCTTAATCAACTGTTTATCAGCAAATCCCTTAGTAAATTCCTTCT
TAGCAAGAACAAAAGACAGACCAGAATGCTCTCGCATAGCTTTATTCCTAAGTAAATTAA
TAAAAGAGTGACAATTCTCCAAGACCAGACTCACCATCAGTGAAACACAATTAGTAAAAT
CCTAAGTCACCATAGTACTAATAGAGTAAGTAGCACGCTTCAGCTCCTCATCATTTAAGC
CCTTAACTTTAAGGAGATCAGCCTGTCGCCTAATCTCACTCCCAGCATCGTCCACATGAG
AATGGGAATGGAGGTGTAGAGCATCATCAAAAACCTGTATAGCAAGATACTCAATAAATA
AACTAGAGCTAGAACTACCATTAATAAAATCCAACTACAGTAAACTAAGTTAGCCAAAAT
ACTCAACAGTAATAATAATAATAATTTTAGTAGAACTCTACCCAAATTAATACCAGCAGT
TCTTAATCATAAATGCCCAATAGATCTTAAGCTCAACAATAACAACCAGGATTCGTAAGA
CCACCTCCTCTAGGTGGAATGGGAGGTCCTCCAAACTTTTAGCTTCAAAATATAGTCAAT
AATATAATCTCTCTAGTAAAGAAGGGTGATATCGACTAAGTGGTAACAGAGATAAATAGA
TCTGGTGTAGACCCAAGTCAGCTCAATGACTCGGCCAACTTCAATCAGCATCTGATATTC
TCTACTACACTCATCCCTGATGACGGATAAGCTACTAGAATGGGCGAGGTTTTAAAGAAA
CTAGGAGTAAATCCTGGCTAAGTTGATACACTGAGTCAGACTCCACTCTATTATGCATGC
AGAGAAGGAAAGAATCAACTTTGCGAGTTTCTAATTGAGAATGGCTGTAATGTAAATCAC
ATAGACACTTATGGGTAAAATCCAATCTTCTATGCCTGCAGAGAGGGCAGGATTGAAACA
ATTAAAAAGCTAGTCCAGCATAACACCCAAACAGATCTAATAGATAATAATGGCTAGACT
CCATTGTTTTATGCAGTAAAGCATGGAAAAGCTGAGGTCGTTGAGTATCTTATTCAAAAT
GGCGCGAATGTTAATATAACGGACAAAAAAGGCATCACTCCAACTACTTTAGCTAAGAGA
TCAAACAAAGGTCAGATATTAGATATTCTTGTAAAGTATGGAGCTGCTCCACTGATAGAT
CCAAATCAAAAGAACAAGGGGGGAAAGAAGTAACCACCTCCTCCTCAGCCCCCAAAACAA
AAGGTCAATGAGAGAAAGAATCCTGCTAAGTACTAATTGACAATGCTTAAGGATGGAGTG
TATTAACCAGTCACTGAAGAAGAACTTGAAATTCTAAAAAGAGAGCACCCTGATATAGCT
AGATACTTTGACCTGCCTGAAGAATCAAATGTGATTGAAGAGCTCCCTATACCTGAAGTC
TCAGAGACAGCGCCAATCTATGATTCATGGGACAAAGCTGCTAAGCGTCTAGTAAATACT
TTGTGGAAACATCAAAACTCCTGGATTTTTCATGAGCCCGTTGACCCAATAAAACTGAAC
ATTCCTGATTACTACGACATAATCAAGAACCCTATGGATTTGTCCTAAGTGAAAACCAAG
TTGAATAACAACGAGTACACCAAGATCAACGATTTCTTGTATGATGTACAATTAATATTC
GATAATTGCTTGCTCTATAATGGAGATTCAACTCAGGTTAGCTAAATGTGCAAGAGTGTT
CGTGACGAGTTCTAAAAATAATACCACATTTTGAACCTTGACTTCTATGTCTGA


>Contig21371.0.g39(protein)
MDQEKQQNVNQAPFDGQQFQTNHHQAQFQQHLNQYEQPQPQQQATVEFEQTYQTQTPSGD
QIMQVQYQSQVHVEKQESSNSAHSPFQNTQPSPNVVQKTVAGVYYQQNNYPPHQEAEEGH
SKSLQQEITQVQGGNQQVIQQQQHQETQQYSDGNSAQLFVGQQFMQSASPAIDIEQSMQN
QPLSLNETPSFRPDFQNQFTQQQQAAQSTVYQQIPQQIPSQQEQKTDQNALAQLYSQVNQ
QKSDNSPRPDSPSVKHNQQNPKSPQYQQSKQHASAPHHLSPQLQGDQPVAQSHSQHRPHE
NGNGGVEHHQKPVQQDTQQINQSQNYHQQNPTTVNQVSQNTQQQQQQQFQQNSTQINTSS
SQSQMPNRSQAQQQQPGFVRPPPLGGMGGPPNFQLQNIVNNIISLVKKGDIDQVVTEINR
SGVDPSQLNDSANFNQHLIFSTTLIPDDGQATRMGEVLKKLGVNPGQVDTLSQTPLYYAC
REGKNQLCEFLIENGCNVNHIDTYGQNPIFYACREGRIETIKKLVQHNTQTDLIDNNGQT
PLFYAVKHGKAEVVEYLIQNGANVNITDKKGITPTTLAKRSNKGQILDILVKYGAAPLID
PNQKNKGGKKQPPPPQPPKQKVNERKNPAKYQLTMLKDGVYQPVTEEELEILKREHPDIA
RYFDLPEESNVIEELPIPEVSETAPIYDSWDKAAKRLVNTLWKHQNSWIFHEPVDPIKLN
IPDYYDIIKNPMDLSQVKTKLNNNEYTKINDFLYDVQLIFDNCLLYNGDSTQVSQMCKSV
RDEFQKQYHILNLDFYV