Identifiers and Description

Gene Model Identifier

Contig15136.0.g101

Standard Name

BRD3a

Aliases

Contig15136_0_g101

Description

Ankyrin repeats (3 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000731702.000065869309806e-55Bromodomain containing protein
SGDYDL070W0.000000000000001999258566166494BDF2 SGDID:S000002228, Chr IV
from 331024-332940, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15136.0.g101(coding)
ATGAGTGAAGAACAAAACCAGTAGGCTTAGATAGTCGATGAGCATATCAATAGGGCCTCA
ATAGACGATTAGGTGCAAGCCAATGTAGGAAATGGAGTTTCAGATCAATAGGATTTAAGT
GTGGGGAGAGATGAGCGTATTTAAGAAGATTAACAACCTAATGGCATTCATAATGATGCC
GAAGATTCTCACCAAACGCACTCTCATCTTCCGCAAAATGAGGCAAATTAGGCAGTGGAT
GTGCAATTAGAAAGTAATCAGAATGTTTAAGAACAAGACTAACCTATGGAGGAAGTTAAG
TATCAGAGAGGCCCTGAGGACTTAATTAATATTCAAAATTTGAATGGATAGGCCGCAGAT
CAAGTAATTTAAGAAGAGGAGGCTGAGATGATGTAAGAAAGCAAATAAGACTAGCAAGAT
ATTATATAGCAGGAAAATTAAAATATTAATTAAGATTAGAATAATGATCAAAATGGAGGA
CATATGGTTGATGATTAGCAAATAGATCAAGAATATGAAAATCAGGAAAATATTAGTAAG
GAGCAGAATAATTAGTATTTAAATGGAGATGAGGTCAAGCCAGACTAAAATCAAGAAATG
ATTGTTGATCAATAATAGCAGTACCAAAACTATTTATAGCATGTGGATAATAGTTAAAAT
AGAGGCAATGATCCAGAAAGCGATGATGAGGGAGTTATATCTACATCAGCCAAACCAAAT
AATGCAAGTTCGACACCACATGCAAGCAAACATGGGTCAGCTAACAATAATAACAGCGCT
CCAGCAAACAATAATAGTGGTACTATGGGGGCCTAATAAAAATAGCCAACCACAACAGGG
AGCGGAAGTATGCAGGGAATTTAAGGATCCAGTGTGGCACCATCTTCTTATCATATGCAA
TAGAACCTATAGATCTCTGCCCAGATTACTAAGTAGATCATGGATGCTGTGAAAAAAGGA
GATGTCAATTTAGTCAAGCAAGAGCAGGAAAAACTTGGCATCAGTATCAAATATATAATG
GAGGAAAATTTGAAACACAATGCGATATTTTAAGGAACTTTAATTAAAGATCATGCTTAA
GCCTAGAAAATGGTTGAATATTTGATATCAGAAGGAGTGGACCCATGTACAAGTGACTCA
CTTAGCTAGACCCCATTGTTCTATGCGAGTAGAGAGGGAAACGTCAATCTAGTAGAAATT
TTTGTAAAAAATGGGTGCCTACCAAATCACTTAGATGCCTATGGTTAAACTTCTATATTT
TATGCAGCAAGAGAAGGTCACTTAGAAGTATGTAAAAAGCTAGCTTTATTAGGTGCCGAT
TGCGACTTGGTTGATCATAATGGCCAGACTCCAATTTACTATGCGGTGAGAGGTAGAAAG
ATTGATACTGTAGAGTTTTTAATTTAACAGAGAGCAGATGTAAATCATGAAGATAAAAAA
CAATAAACTCCAATGATAATCGCTAGAAGAAGTAATGCACAATAGATCATTAGTCTACTT
ATAAAAAATGGGGCTAAAACATTAGAAGATTTGCGCTAATAAAGTAAACAGAAAAAATAG
GCTGCGGTGACTTAGTAATAACAACAAGAGGTTGTAATATAATAACCAACTCCCTAACTA
CCATCAAACTTGGCTAAGAAGAATCCTCCTGCAGCAACTTCAGAGAAAAAATAATAAAAG
AGATACGTGCTCACAGTGCTAAAGGATGGTGCATGGGAGCCAATTTCCATTGAAGAAATG
GATAAATTTGAATAAATGTACCCAGAGATTGCTAAGTTTTGGAAAGACCCTTCTTCTCTA
GAAAAGCTCTAACTCCCTAAGTTCCCTGAAAACGCACCGATTTATGAATCTTGGGATAAA
GCCGCGAAAAGATTGATGAATTCAATATGGAAATTTAACTAATCTTGGATCTTTCATGAG
CCTGTAGACCCTGAGAGACTCGGCGTCCCTGACTATTTCAATATAATAAGGAACCCAATG
GATTTCGGGACTATAAAATAACGTCTTAATACTAACTACTATCACAGGATGTAGGAGTTC
TTAGACGACATGCAATTAGTCTTTGATAATTGTTTAAAATTTAATGGGGAAGAAAATAAT
ATAGGAAAAATATGTAAAATCGTAAGAGAAGAATTTAAAAGATTATATGAGCAATTAAAT
ATTGAATTTTACCTTAATTGA


>Contig15136.0.g101(protein)
MSEEQNQQAQIVDEHINRASIDDQVQANVGNGVSDQQDLSVGRDERIQEDQQPNGIHNDA
EDSHQTHSHLPQNEANQAVDVQLESNQNVQEQDQPMEEVKYQRGPEDLINIQNLNGQAAD
QVIQEEEAEMMQESKQDQQDIIQQENQNINQDQNNDQNGGHMVDDQQIDQEYENQENISK
EQNNQYLNGDEVKPDQNQEMIVDQQQQYQNYLQHVDNSQNRGNDPESDDEGVISTSAKPN
NASSTPHASKHGSANNNNSAPANNNSGTMGAQQKQPTTTGSGSMQGIQGSSVAPSSYHMQ
QNLQISAQITKQIMDAVKKGDVNLVKQEQEKLGISIKYIMEENLKHNAIFQGTLIKDHAQ
AQKMVEYLISEGVDPCTSDSLSQTPLFYASREGNVNLVEIFVKNGCLPNHLDAYGQTSIF
YAAREGHLEVCKKLALLGADCDLVDHNGQTPIYYAVRGRKIDTVEFLIQQRADVNHEDKK
QQTPMIIARRSNAQQIISLLIKNGAKTLEDLRQQSKQKKQAAVTQQQQQEVVIQQPTPQL
PSNLAKKNPPAATSEKKQQKRYVLTVLKDGAWEPISIEEMDKFEQMYPEIAKFWKDPSSL
EKLQLPKFPENAPIYESWDKAAKRLMNSIWKFNQSWIFHEPVDPERLGVPDYFNIIRNPM
DFGTIKQRLNTNYYHRMQEFLDDMQLVFDNCLKFNGEENNIGKICKIVREEFKRLYEQLN
IEFYLN