Identifiers and Description

Gene Model Identifier

Contig18584.0.g108

Standard Name

BRD1c

Aliases

Contig18584_0_g108

Description

Bromodomain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00439 ) Bromodomain
  • ( pfam06831 ) Formamidopyrimidine-DNA glycosylase H2TH domain
  • ( pfam14300 ) Domain of unknown function (DUF4375)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004834902.00017271388466e-38Bromodomain containing protein
SGDYGR252W0.00000000000009996062864481225GCN5 SGDID:S000003484, Chr VII
from 996869-998188, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18584.0.g108(coding)
ATGAGTGTGACTGAAAAGAGTGATATCAGATCAGAGGATAAATCCAAACTAAAAGAAGTT
ATTAATCAAGTTGAGGAAGATCAATAGTCCTATGAATTCAGAGAGCCTGTCGATTGGAAG
ACACTTGGGCTGACCGACTACCCAGAGATAATAAAGAAACCAATGGATTTGTCTACTCTA
CGCAAGAACTTGGCAAAGGGAAAGTACAAAAAGTATGAGGAATTCTTCAAGGATTTGCTT
TTGATATGGGATAATTGCAAGCAGTACAATATTCAGGGTTCAGACATTTACAAGCAAGCT
GAGCACTTGGAGAAGATCAGCAAGAAATTAATCAGTAAGTTCAAGGAAGAAGTAGGCTTG
GGCAGTGTTAAGACTAGCTCAGGTGGCAAGTCAGGTAACAAAAAGAGAGAAGAAACTAAG
AGAAACGGTGAATCAGATGGAGAAGGAGATGGAAATGGTGATGAAGACGAGGATATAGAG
GAGGTACCATTCGAACGAAAAGTCCACTTCACTGAAAAAGTGCGAAGATTGACAAATGAA
GGCCTCACCAGATTGGTCAAGAAAGTTAAGGAAGTATGTCCTAAGGCTCTTGAAGATGTA
GACGATCAGAAACTGCACATCAAAGTCGATGAGATTGATAAGGATAGTTTTGAACAGCTG
GACAAATTAGTGGATGAAAACCTAGGCAAGAAAGGAGGGGATAGCGGCACCAATAGAGGA
GAGGAACCAAGCAAGAGAAGACCTAAATTGTGA


>Contig18584.0.g108(protein)
MSVTEKSDIRSEDKSKLKEVINQVEEDQQSYEFREPVDWKTLGLTDYPEIIKKPMDLSTL
RKNLAKGKYKKYEEFFKDLLLIWDNCKQYNIQGSDIYKQAEHLEKISKKLISKFKEEVGL
GSVKTSSGGKSGNKKREETKRNGESDGEGDGNGDEDEDIEEVPFERKVHFTEKVRRLTNE
GLTRLVKKVKEVCPKALEDVDDQKLHIKVDEIDKDSFEQLDKLVDENLGKKGGDSGTNRG
EEPSKRRPKL