Identifiers and Description

Gene Model Identifier

Contig11804.0.g30

Standard Name

BRD1b

Aliases

Contig11804_0_g30

Description

Bromodomain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00439 ) Bromodomain
  • ( pfam09888 ) Uncharacterized protein conserved in archaea (DUF2115)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007292301.0003081162615753e-33Bromodomain containing protein
SGDYGR252W0.00000000002000577768187062GCN5 SGDID:S000003484, Chr VII
from 996869-998188, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11804.0.g30(coding)
ATGTAAGTCTTAGCAAATCTAAACTTGCTTAAAATTTCAATCTTAACACTTAATATTCTT
AGGAACGCATAAAAAGGTGGACCAATTACCCCAGCTCCAATTAAGAAGGAAGATATACCT
AAGATCAAGCAGATGATCGAGTCAATTGAAGAAGGTCCAAACGCAGAACCATTCCTTGAA
CCTGTCTAATGGCAAGAACTTGGGCTTGTCGATTACCCCTAAATCATTAAAAGACCAATG
GATTTTTCAACTGTCAAGATAAACATGGAAAATGGCAAACTTAAGACTTATGATGAGGTG
TTCTCAGAGATTCAACTTATATGGGACAACTGCAAGACCTACAATATGGCTGGATCAGAC
ATATACAAGTTAGCTGAGTACATGGAAAAGATAACTAAGAGAACAGTTTAAAAGTTCAAG
TCTCAGATGGGCATTAATACCGCTCCCACCACTTCCTTATTAAAGAAAGCTCCACCTAAG
GACAACAAGAAGAGTGTCAGAATCAACGACGACAATTAAGATGGAGAAGAAGAGGAAGAT
ATCACAACTGTGACTGTGGAAATGAAAATGGACTTCGTTGAGAAAGTAAAGAAACTTGAC
AATCAAGGATTAACCAAGATGGTGAGTCATATTCAAACCTTGATGCCATCCTCCTTGAGT
GATTTAGAAGATGAAAGACTACAGATCAAAATTGATGACTTCGATAGAGACACTTTCAAG
AAAATCAATGACTTTATAGATGAAATTCTTCTTAATTCTTAGCCATCAAAGAGACAAAGA
ACTTAATGA


>Contig11804.0.g30(protein)
MQVLANLNLLKISILTLNILRNAQKGGPITPAPIKKEDIPKIKQMIESIEEGPNAEPFLE
PVQWQELGLVDYPQIIKRPMDFSTVKINMENGKLKTYDEVFSEIQLIWDNCKTYNMAGSD
IYKLAEYMEKITKRTVQKFKSQMGINTAPTTSLLKKAPPKDNKKSVRINDDNQDGEEEED
ITTVTVEMKMDFVEKVKKLDNQGLTKMVSHIQTLMPSSLSDLEDERLQIKIDDFDRDTFK
KINDFIDEILLNSQPSKRQRTQ