Identifiers and Description

Gene Model Identifier

Contig17553.0.g91

Standard Name

BRCA2b

Aliases

Contig17553_0_g91

Description

BRCA2, helical

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17553.0.g91(coding)
ATGAGAGAGCTCCCAGAAGATGAATTTATCAATGAAGAAATTTTTAATCTAAATATTCTT
ATGCTTAACGACTTTGACAATGAAAGGATCAGGAAAATGGGAAGAGATCATATCGAAATC
ACTCCAAGAGAATTAAACTATGAAGATTAAATACAACGAGCACTCTAAGAGTCACTAAAA
CTAGATTAAAGTCAAAACGATTTATAGAAAAATATGAAACTCCTTGAAAAAATAAAAGCT
TTAGAACAAGATCACAACTTATTCCCTTCAAATATAGATCTACTCTCTAAAGACTTAGAT
AAAAATTTAAACATTTCAAATTAAAGGAATGGTCAAAATGGTTTAATTGATAGGCAACCG
TAGACTAAAGAGGATCAAGCTTTTCAAAAACTCAATGTGCTAGATTATTCGAAAGAAATC
AAAAAGATGAAGGATATGGTTTAAAATGGAATCAGGAATAATCAGGATAGTCAATAGATT
CAGAGAAGCCTTAACAATATCAGTGAAAACTTATACAAAAAGATTGAGAGAAACAAAAAG
GAAATGAGAATTAGAATAAAATCAAGCGTCCCAAATTGCTTCACCTTTTTGAAATACAGA
TTTTTCAAAGATGAATATGTGGATATTTCAGTTAGAGGCATTAATTAGGCTCATTTCACA
ATGAAGAAAGTAATTGATAAATTTATCGAGTACAGCAGATAAAATCTTAGCCGTGAAATC
TTTTAAGCTAGTAAATAGACTCAAATCGATAACTTTACAGTTTATTAAGTTATCCTTTCA
ATTATTCCAATAAACGAAGAGGAGTACTAAAACAATAGCATTTAGCCACAGGCTATATAG
ATCGAAAGAATATCAAATAGTAGTCGTTAATCATTGGTACAGCCTCCTTCTCAAGTTAAA
GTTAGAGATGAGATAAATCAAGACAGGAAAAGTATTTCTCAATAAAAAGGACAATTCAGA
GACAATGTCAGTTCTCATAGTAACAATTCTAATGTAATGAGTTAAAGTGTGAGCAGCAGA
ATCTAATAAATTTAAAGTTAATTAAACCATCAACCCGAGCAATATGATACTTCATTGAGT
TCCTACGTTATCGATGTAGATACGTATTGGGATAAAACTGCTGACTTCGTTAAGCAAGAA
AATGACATTTACATTGGGAAAAAACTTGATGCAAAATTGTTGGAATAAGTATTGCTTGAT
AATTTCTACAATAATAACAGAGTGTTAAGACTTATTGGCAATAATAGAGCAGACATGAAA
ATGTGGTAAGATGCTGTGTAAAGTATCACATAGAATCATTAGTATGGAGTTATTGCATAG
ATTTCTAATACTCAAACCTTCAGGAAATTCCACGACTATTTTAAGAACTAGCAAATAGTA
ATTGTTGCAACAATTTAGTTATAATGGCGCTAATGA


>Contig17553.0.g91(protein)
MRELPEDEFINEEIFNLNILMLNDFDNERIRKMGRDHIEITPRELNYEDQIQRALQESLK
LDQSQNDLQKNMKLLEKIKALEQDHNLFPSNIDLLSKDLDKNLNISNQRNGQNGLIDRQP
QTKEDQAFQKLNVLDYSKEIKKMKDMVQNGIRNNQDSQQIQRSLNNISENLYKKIERNKK
EMRIRIKSSVPNCFTFLKYRFFKDEYVDISVRGINQAHFTMKKVIDKFIEYSRQNLSREI
FQASKQTQIDNFTVYQVILSIIPINEEEYQNNSIQPQAIQIERISNSSRQSLVQPPSQVK
VRDEINQDRKSISQQKGQFRDNVSSHSNNSNVMSQSVSSRIQQIQSQLNHQPEQYDTSLS
SYVIDVDTYWDKTADFVKQENDIYIGKKLDAKLLEQVLLDNFYNNNRVLRLIGNNRADMK
MWQDAVQSITQNHQYGVIAQISNTQTFRKFHDYFKNQQIVIVATIQLQWRQ