Identifiers and Description

Gene Model Identifier

Contig18632.0.g13

Standard Name

BRCA2a

Aliases

Contig18632_0_g13

Description

BRCA2, oligonucleotide/oligosaccharide-binding, domain 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

  • double-strand break repair via homologous recombination (IEA) | GO:0000724

Domains

  • ( pfam09103 ) BRCA2, oligonucleotide/oligosaccharide-binding, domain 1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004372600.00000000000008999700526206354hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18632.0.g13(coding)
ATGTTCGCATTGAGAAATAATCAACAAAAGCAAACAAACCCTGTAGCAAATTAAAAGTAA
GCACCTGCATCTTAGGTTGCTTAAAACAATTATTCTAACCTGAAGCCAACTCTTGGGTTG
GAAAGCATTTCTTAAACTAAGCAACACCTGAACGATTAAATAGGTGATGCAAACTCCGCA
ATGCCAGACTAACTTGAAGATGAAATGCTTGAACAGAGTTTAAAATTGCAATATGAGAAA
AGCTAATCAAGCAAAAAATAGCCAGAGTTTTAGACTAATGCTCTTCCTTTAAATGTTATC
AATTCCAAAAAAGAAGAATTTAAACATAATTCCTCTAATACAAACGCACATCCTCCTTAA
AAGTAGAACTCAATTACAGATACTTAAAGATTTTAGTAGGCTCTTGATGATCTGCAAAAT
GATGAATTGAGTCAAATTCAGCCATTGATAGAAGATGAGGACAGCTAAATAAGAATGAAT
AATATAAGCAAGAATGCTAAGTTTAAGATGCCAACAGATATAAGACCTTCAAACTCGTAA
TCTAAGGGAAGCCTCAAATCCAACTCTCATAGTTTGGATAAGACTAAAAGTGAGTCAAGA
ATTGAGAGTAGCTCAAAAGGTTCAGTTATTAAGCAGACTGACTTTTAAATTATAGAAGAT
TCAAAGAGCATTGATTTTTAAATGTCAGACTTTGAGTAGAGTGAAATCATCACAACAGAG
GATCTTATTGGTTTATTTACATAAAAGCCCTAAATGTGTAGCAACTCAGCTAGCATTCAA
GGGTCTGATCAAGTTAACCAGTTCAAACCTATTTAAAATTAAATAGCTCCACAGATCTAA
GTTAACTAATAATCTCCTCAGTTTACAGGTCTATAGGTTCAGTAAAACTAAAGAGGTTAG
GTTAAGTATTCTGGTATTTCAGGAATAAGCAGCATTAAGCAAGGTCCTCAATCAAATTAC
TCAAACAAGAATGACAGCACTACGCAGTTCAATGATTCCCTTAACATCAATGGATTTTCA
AGTTCAGTCACTGATTTGAATAAGAGATACAGCTATAATCGAGGTCAATACAATAAGCCC
AAAGACCATATCAATAGAGGCCAAGATTAACAGTAGTAGGTTATGAATTAAAGCAACTCA
TTTTAAAACTAGCAGCAGTATAATCATCAATAATAGATCTAAAATTAACAATAGCAAACA
GCAAGTTAGAATCAAAGCTCAAATCATGTTGATATATTATAACATTATTAAGTTCTACTT
GATCAATCTAACAAACAAAAAGATACTTACTTCTAAATGCTAATGCAGAAAGATTCTTAG
ATTAATGAAATCTTTAAATAGAAAGAGGACTATAAAGATAAATATATCCAATCCCTTGAA
AACTAACTCTAAAACAAAGATGGAATGCTTCAATAAATGATTACTAACTTAACTGAAATA
ACCCAGAGATCCCTCTCAGCTCAACCCCCAGTAAGTAGGAGAATGGACAGAGATTTTACA
TTTCCCAAGAATTCTTCAAAGCAAATTAATCAAAATGAATCTTAAAATTCTTCAGCTGGT
TTCAAGAATTTGAGGGAAAGAGCTAAATCTTCTTAATAAGAAGAAAATAAGAATGACGAG
AGTAAATCTTTAAATAACGTAGGATTTTTCAGGGGAGGGAATAAACAAATCAAAATGAAC
ATCAAGCCTGAGCACATGAATAGAATTGCTAAGATATTCTCAGATAGCGATTAAGAAAGC
TCAAAGAGTGACGATTCATCAAAAGACGAGAAAGTTGGTTTTAAGGCCCCAGTTCTATAA
AAAGAGCCATTGCAAAAGTAAAAGGTGAAGGATGAAAAAATTGGGTTTAATCTCAATAAT
CAGAATAAAAAGTTTCACAACCCTGTAAAGCCAGACATTCCTTTAAAAACAAGTGATGTG
ATTATGAAAGACTAGGATATTGCTAAGAAGAGCAGCACATATTAATCTCCCCAGAAAAAT
GATTAACTGAATCAATCAGCTGTTCATTTATAGTAACCATAGAAAAACATGTTCAAGTTT
AAAGGTGAGGTAGGTAATTAAAATCAAAGTTTGCATAAGAATATGGAGCTTTCATCTAAA
TAAAAAGATAAAAAGAGAACATTTTAGGAGTTTTAAGAATAACAAGAAGATAAATCTATT
GAGATTATGAATGGTGCTAATTCAAAGAGATTCCACTCGAACAATTAAGAGTCAAGTGAT
CCAATGAATAAAAGAATTACAGTAGATGACGTTAAGTACTTATTTGCTAAAGATTTTAAA
CCCTTGAGAGTCTCCATAAAAGAAAAGCATCAAGAAATGTTACGAGCCTTAGCAGAACAA
AGTAGAGATAATATGAAGGATGAAACAAAAGAATTTACAAAGCCACTTGTTTATGATATC
AAATCTGCTAAACATTTCATGGTTAACTGCATTTGTCCAGGCTAATCTGATCATAATGAC
AAATTTTACAATAAGAGATTATCCTCTGAAATTCTTTGCAAGATTTGCTCTGATAAGCAT
CGAATAAACTATGTTGAACTCCTTAAAATATTTGAAGTGATACTCAAACCATCTTTTGAA
GAATTTGATCAAGAATGGATGATGAATGCATATTCACATGTAATCTGGAAATTTGCTAAC
TTTGAAGTACTTACCGGCTTGAAACTTCTTAATTTTGAAAATATTACCTTCAAAATTTTA
CAAAAGTACAACAATGAGTTTAAAGAGGGAAAAAGATCGTTCTTGTAGAGAATAATGTAG
AAAGATGAAGGAGCCCACTAACATTTCATTGCTGTTGTTTCAAGTATTGCATAAACTTAA
GATTCTTATGAGCTTACCCTCTCCGATGGTTAGTATTACATAAAGTGCAATCTGAAATCT
ACTGGTTTTGGAAGCAACGATGACTAAATCATTCATTTACTTACAAGAGGCAAGATTTTT
GTTGGCCAGAAATTGCATTTGATTAATTAAGCTTTAACCAGAGTGGACACTAAACCATAA
CTTAAGAATTCATCCTTCGTTTCTTAAACAAAACATTTTTACTTGAGTCAAGAGGATAAA
TTCTAGTTGCAACTAAACTACAACGGCATTTGGAGAGCAAGAGCTTTTGAGAAACTTGGG
TAATAGAAACCTAATAAAATCATGATTAAAAGTCTCTCGTCTATAGCTTAGCGCTCTGGA
GTTATTCCTATGATTGATTGCATAGTTGTCAAGAAGTATCCCATTTATTTCACAGAGTTC
TATCAGAATGAAAATGGATAAAATTGCAGACTTCTCAGAAACAAACTTGCCATTGAATCA
CTTTAATAAAAGTAGATTGACAGATTCAATGAAAAGATAAAAAGTATGATTGAAGGAAAA
AAAACTAAAGATAATGGCCTTGAACAGCACGAGATTGAATAATTGAGAAGGAAAATGATA
AGTAGCTTTAAAATGATGTTTAAAGTTAAAGTTGTAGATACTTTGAAGCCAAACCTTCCA
GCTATGGTCGCTTTCTATGAAGCTAATGAAGATATATATTCAATGATCAGCGCTGGAGAT
AGACTAAGACTTTCAAACTTAACTCCAGCTATGATGTCTTCTGACAACATGCTTAATCTT
AATATGATTAAATCTTCAAAGATTATCCATTTCACTTAGAATGTACTGAAGCCAAAGAAA
CAGCAAGATCTAATTGAATAGTATAAACAACTCTAAGAGCACTCTTTATCGCTTTCAGAT
TTCAGAGCGAAATTCTACTCAGTCAGTAAGGATCATGATATTACTGTCGTTGGCTACTTA
CTTAAGGTTATTTCTTAGAAATCTCAGTAAAACTAGTATGGTTCTAGTGCAGCTACCTAA
CTCAACGAAGAAATTTGGAAAATAATGATTCTCACTCACGAACAAGAAATAGTTTGCATT
GAGATTCAGGAGAAAGGTTTCATCCCAACCAAAGTTTTTCCAAAAGAAGGGTCTTACCTG
CTTTTCGATAACTTAACTTATCAATAAACCGTGCTTTTGAAACGAAAAGATGCTTCTATT
TAAATGTTTGAGACACCCTAGGATTCCAAGACTCTCATTTAAGATCACAAAAATCAATTC
TTATATGATGTGCTGAAGATGAGTATCAAGGGATCATACAGAATGGTCACAGCCAATCAA
AGTGAGGAGACTTAAACTATTAAGTTACTTGTCAAAGAGAAGAGTGTTTTAAAGTAAGCT
GAGTAGAGAGTGAAGATGATCATGAATCAAGGACTCAAGAGAAGTGATGGAGCTGCTTAT
AGTCAACACACTCAAAATGAAGTCAGTGAGTTGTCTGAAATCGTTGAAAAATGA


>Contig18632.0.g13(protein)
MFALRNNQQKQTNPVANQKQAPASQVAQNNYSNLKPTLGLESISQTKQHLNDQIGDANSA
MPDQLEDEMLEQSLKLQYEKSQSSKKQPEFQTNALPLNVINSKKEEFKHNSSNTNAHPPQ
KQNSITDTQRFQQALDDLQNDELSQIQPLIEDEDSQIRMNNISKNAKFKMPTDIRPSNSQ
SKGSLKSNSHSLDKTKSESRIESSSKGSVIKQTDFQIIEDSKSIDFQMSDFEQSEIITTE
DLIGLFTQKPQMCSNSASIQGSDQVNQFKPIQNQIAPQIQVNQQSPQFTGLQVQQNQRGQ
VKYSGISGISSIKQGPQSNYSNKNDSTTQFNDSLNINGFSSSVTDLNKRYSYNRGQYNKP
KDHINRGQDQQQQVMNQSNSFQNQQQYNHQQQIQNQQQQTASQNQSSNHVDILQHYQVLL
DQSNKQKDTYFQMLMQKDSQINEIFKQKEDYKDKYIQSLENQLQNKDGMLQQMITNLTEI
TQRSLSAQPPVSRRMDRDFTFPKNSSKQINQNESQNSSAGFKNLRERAKSSQQEENKNDE
SKSLNNVGFFRGGNKQIKMNIKPEHMNRIAKIFSDSDQESSKSDDSSKDEKVGFKAPVLQ
KEPLQKQKVKDEKIGFNLNNQNKKFHNPVKPDIPLKTSDVIMKDQDIAKKSSTYQSPQKN
DQLNQSAVHLQQPQKNMFKFKGEVGNQNQSLHKNMELSSKQKDKKRTFQEFQEQQEDKSI
EIMNGANSKRFHSNNQESSDPMNKRITVDDVKYLFAKDFKPLRVSIKEKHQEMLRALAEQ
SRDNMKDETKEFTKPLVYDIKSAKHFMVNCICPGQSDHNDKFYNKRLSSEILCKICSDKH
RINYVELLKIFEVILKPSFEEFDQEWMMNAYSHVIWKFANFEVLTGLKLLNFENITFKIL
QKYNNEFKEGKRSFLQRIMQKDEGAHQHFIAVVSSIAQTQDSYELTLSDGQYYIKCNLKS
TGFGSNDDQIIHLLTRGKIFVGQKLHLINQALTRVDTKPQLKNSSFVSQTKHFYLSQEDK
FQLQLNYNGIWRARAFEKLGQQKPNKIMIKSLSSIAQRSGVIPMIDCIVVKKYPIYFTEF
YQNENGQNCRLLRNKLAIESLQQKQIDRFNEKIKSMIEGKKTKDNGLEQHEIEQLRRKMI
SSFKMMFKVKVVDTLKPNLPAMVAFYEANEDIYSMISAGDRLRLSNLTPAMMSSDNMLNL
NMIKSSKIIHFTQNVLKPKKQQDLIEQYKQLQEHSLSLSDFRAKFYSVSKDHDITVVGYL
LKVISQKSQQNQYGSSAATQLNEEIWKIMILTHEQEIVCIEIQEKGFIPTKVFPKEGSYL
LFDNLTYQQTVLLKRKDASIQMFETPQDSKTLIQDHKNQFLYDVLKMSIKGSYRMVTANQ
SEETQTIKLLVKEKSVLKQAEQRVKMIMNQGLKRSDGAAYSQHTQNEVSELSEIVEK