Identifiers and Description

Gene Model Identifier

Contig21538.0.g90

Standard Name

BRCA1

Aliases

Contig21538_0_g90

Description

PHD-like zinc-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam13771 ) PHD-like zinc-binding domain
  • ( pfam00628 ) PHD-finger
  • ( pfam13832 ) PHD-zinc-finger like domain
  • ( pfam13821 ) Domain of unknown function (DUF4187)
  • ( pfam03446 ) NAD binding domain of 6-phosphogluconate dehydrogenase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005821009.99967697349061e-30PHD-finger family protein
SGDYPR031W0.00000005999527666938375NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21538.0.g90(coding)
ATGAAAATAAAATAGAAATTAATGTAGGTTTTAAGCATCGTAGAAATTTGTGTTAATGAA
AAAGTCCGCAAGATTGATGCTATTTTGGATTTAGCGCTCTCTGCAAACTTAATAGATTTT
AAGAAACATTTATTGACTTAATCTAAGCTTTCATCAACTTAGTATGATAAATACCTGCTC
TTGATTTAAACTGATAAATTGAAAATAACATACTAAGAATCAGATGAGATAATAGAGTAA
AGACCAAAATATCATGAGGTTTATGAAGCAATAGCTGACGATGTGAATTTGATGCATTAG
ATAGTTTAAGTTGTTCATCAAAACAGAAAATTGATATTTTAACTTAAGAGGTTCACTAAT
CAATACTTATCAGTACTTGACCCAAGCAATTCCTAAACTCATACTAAGAGACGCCTAATA
AAAGCTACAAAGGCTAAAAATGTGATAGAATTCGATAAGGATGGATAAGTAGTCAGAGAC
AAGTTGTAAGTGTTGCAAGAAAGACCCAGATATAAAATACATCCAATTGAGTCAGGTTAT
GAATACTGCTACTTCTGTAAAACCTCGTCAAGAGATGAGGAGCTTAGGGTTAAATGTGGA
CCAGTTTATGGTCCTATTAGGGCTGGAGATAAGAGTATATTTTTGCATGAACTCTGTGCA
CTTTGGACTCCAGAGATATTCCTTGACGGTAAAAACAAATTCAAAAATCTATCAAAAGCT
ATTAAACGATGCAAGAAAATCAAATGCTCATGTTGTAAGGAAAAGGGTGGTGGCCTGGGT
TGCTTTGTAAAGTCTTGTGATAAAAGTTATCATTACTTATGTGCAAAAGTGAGCAACTGC
CTGTTCGTGAATTCCAGATTTATCATCTACTGTGAGAATCATAGGAATGAAGCACCCGAG
GAATACTTAGAGGAGGAGAAAATCGAAGAGGATTAAGATGACTAGCTGTAGCATTATATT
TGCTCAATATGCAAAAGTGGATTGGATGAATAAGTGATAATGATATGTGAGGGATGTGAC
AAGGGTTTTCACTCTAATTGCCACTAGCCTCCAATTAACATAGAAAATATTGATGAGGAT
GAAGAGTGGTTTTGCAGAGATTGTCAAGAGGAGCAAAACGATAGATAACAAAACGATGAG
ATGATAATTAATACGTGA


>Contig21538.0.g90(protein)
MKIKQKLMQVLSIVEICVNEKVRKIDAILDLALSANLIDFKKHLLTQSKLSSTQYDKYLL
LIQTDKLKITYQESDEIIEQRPKYHEVYEAIADDVNLMHQIVQVVHQNRKLIFQLKRFTN
QYLSVLDPSNSQTHTKRRLIKATKAKNVIEFDKDGQVVRDKLQVLQERPRYKIHPIESGY
EYCYFCKTSSRDEELRVKCGPVYGPIRAGDKSIFLHELCALWTPEIFLDGKNKFKNLSKA
IKRCKKIKCSCCKEKGGGLGCFVKSCDKSYHYLCAKVSNCLFVNSRFIIYCENHRNEAPE
EYLEEEKIEEDQDDQLQHYICSICKSGLDEQVIMICEGCDKGFHSNCHQPPINIENIDED
EEWFCRDCQEEQNDRQQNDEMIINT