Identifiers and Description

Gene Model Identifier

Contig21285.0.g11

Standard Name

BOP1

Aliases

Contig21285_0_g11

Description

BOP1NT (NUC169) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam08145 ) BOP1NT (NUC169) domain
  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam12894 ) Anaphase-promoting complex subunit 4 WD40 domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005326102.9998475177091926e-177hypothetical protein
SGDYMR049C5.002003259710477e-145ERB1 SGDID:S000004652, Chr XII
I from 370517-368094, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21285.0.g11(coding)
ATGAGCACCTCAAATAAGTAATAACCCAGAAAGGGAAAACTAATCAAGAGAAATCTCCAG
CAAAGAGACCAGTACAGCTCCATGGCAGAGGACACCGCCTCACAAGTAAGTGGGGGTCAT
AGATAATTGGCGAAGAGATCTACCAGGGCTAATTCTGAGACTAATGCCTCTCAAAGAGAC
AACCAATCTGTTAAAAGTGGGCAGTCAAGTGATAGAAAATCATCTGGAAACGGTAAAATT
TATAGCAGAACAAGACCACCCCACAAGTACTCAGCTGAAGACAAGGAAAAGGTTTAAGAG
ATGGGATTGAACTTAGGAGACTCCGATGATTCATCAGACGAAGAAGTGCTTTTAAGAACT
GGAAATGTCCCAAGAAAATGGTACGAGCTTTACGATCATCAAGGTTATGATATCAAGGGT
AAGGCAGTCGCAAAGATGCCAGAGCAAGATGAGCTCACTCAATTTATTGAGAGATAGAAC
GATAAGGAGTGGTGGCTAAAGATCACTGATGAGCTAAATAACAAGCAAGTCAAGTTGTCC
AGAGGGGATTTGGAGTTAATTCAGAGAATTAGATCTGGTAAAACTGCAGAGAGAATGGAT
CCTAATGACTTCATAGTCGAGTTTGATAATGAAAAAGACTTTATCCATCCATTCAGTAAT
AACGAGCCAAAGCGTAGATTCCAGCCATCAAAATGGGAAAGACTGAAAGTCAATAAATTC
GTTCAAGCACTTAAAAAGGGCTGGATGAAGACTCTTGAAGAGAAGGAGAAAGAAAGAGAT
GAATAAGAAAAGAAGGATGAGAAAGTTTGGGATATCTGGGAAGACGATTCTGTAGTCACC
TGGAAACCAAGAAAGATGCCAAAGGCAATTGCAGCACCCAAAAGAGACCTCCCAGTTCAC
GCTGAATCATACAACCCACCCGATGAGTATCTTTTGGATGATAAGGAGAAGCAAGAGATC
GAGAAGTTAGATGAAGAAGATAGGCCATACAATTTCCTACCATAGAAATTCGAAGCCTTA
AGAAAGGTACCAATTTACTAAAACTTGATCAGAGAGCATTTCGAGCGCTGCCTTGATCTC
TATCTCTGTCCCAGAGTAATGAAAAAGAAGGTTAACATTTCTGATCCATCACAATTGATC
CCAGAGCTTCCCCAACCATCAGACCTAAAACCCTTCCCTACTCAGCTTTCAATTGAATAT
AAATTCCATAAAACATGTGTCAGATCTATCTCTTTGTCACCATGTGGACAATTCTTAGCT
TCTGGTGATGAAGATGGAAACTTAGTTATATGGCATGTGTAAACCACAAGAATTATCAGA
AAATATAAGTTGGCCAACTCAGTTGTTGATTGCGTTGAATGGTGCCCAAACAGAAATACT
TGCATCTTATCTGCATGTAATGAAGAGTTTGTGTACTTGATACAACCACAAATCTATTCT
TAAACAATTAATGAGAGTACCAATCAACTTGTTATGATGTCTGAGAAAATCTATCAACAA
GAAGTCATTCTTAACGATAAGAAAGAGCAGCATCTCAAGTGGAACTTTGAAGAAGATCAA
AGAGGAGTTAAAATGATTAAAATTACCTTCAGTAACATTATTGGTAAGGTAGTATGGCAC
TCAAAAGGAGATTATTTCGCAACAATGGCAAACAACCTCCAGTCCTCTCTACAAGTTATG
ATTCACTCCTTAGGTAAATCCTCTTCCCAGCGTCCTTTCACCCAAGCAAAGGGTATCATT
TAAGCTATGGAATTCCATCCAACCAAGCCTCACTTCGTCGTAGCCACTCATCACACAGTT
TTCCAATACAACTTACAAAAGCAAACTATAGTTAGCAAGTATCAATCTGGAGCCAAGTGG
ATCTCCAGCATCTCCATGCATCCCAAGGGAGACAACTTCATTCTTGGTACCTACGATAAA
AAGATCATCTGGTTTGATATGGACATGGGTTCATCACCCTACAAAAACCTCAAGTATCAT
GATAAAGCTATTAGATAGGTTAATTACTCAAAGAAACACCCACTCTTTGCCAGTTGCTCA
GATGATGGTTCAGTTAATATTTTCTATGGCTTAGTATTCAATGACTTGCTACAAAACGCA
CTTATAGTTCCAGTTAAAATCCTCAAGGCTCACGAACCAAATAAAAAGAGCGGTCTCGGT
GCTATGGATTGCAAATTCCACCCCACTTAACCTTGGGTTTTCAGTTGTGGCTCAGAAGGC
TCCATTAAGCTCTGGGTTTGA


>Contig21285.0.g11(protein)
MSTSNKQQPRKGKLIKRNLQQRDQYSSMAEDTASQVSGGHRQLAKRSTRANSETNASQRD
NQSVKSGQSSDRKSSGNGKIYSRTRPPHKYSAEDKEKVQEMGLNLGDSDDSSDEEVLLRT
GNVPRKWYELYDHQGYDIKGKAVAKMPEQDELTQFIERQNDKEWWLKITDELNNKQVKLS
RGDLELIQRIRSGKTAERMDPNDFIVEFDNEKDFIHPFSNNEPKRRFQPSKWERLKVNKF
VQALKKGWMKTLEEKEKERDEQEKKDEKVWDIWEDDSVVTWKPRKMPKAIAAPKRDLPVH
AESYNPPDEYLLDDKEKQEIEKLDEEDRPYNFLPQKFEALRKVPIYQNLIREHFERCLDL
YLCPRVMKKKVNISDPSQLIPELPQPSDLKPFPTQLSIEYKFHKTCVRSISLSPCGQFLA
SGDEDGNLVIWHVQTTRIIRKYKLANSVVDCVEWCPNRNTCILSACNEEFVYLIQPQIYS
QTINESTNQLVMMSEKIYQQEVILNDKKEQHLKWNFEEDQRGVKMIKITFSNIIGKVVWH
SKGDYFATMANNLQSSLQVMIHSLGKSSSQRPFTQAKGIIQAMEFHPTKPHFVVATHHTV
FQYNLQKQTIVSKYQSGAKWISSISMHPKGDNFILGTYDKKIIWFDMDMGSSPYKNLKYH
DKAIRQVNYSKKHPLFASCSDDGSVNIFYGLVFNDLLQNALIVPVKILKAHEPNKKSGLG
AMDCKFHPTQPWVFSCGSEGSIKLWV