Identifiers and Description

Gene Model Identifier

Contig17672.0.g106

Standard Name

BMS1

Aliases

Contig17672_0_g106

Description

Protein of unknown function (DUF663)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04950 ) Protein of unknown function (DUF663)
  • ( pfam08142 ) AARP2CN (NUC121) domain
  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam02367 ) Uncharacterised P-loop hydrolase UPF0079
  • ( pfam10662 ) Ethanolamine utilisation - propanediol utilisation
  • ( pfam03205 ) Molybdopterin guanine dinucleotide synthesis protein B
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam08477 ) Miro-like protein
  • ( pfam13401 ) AAA domain
  • ( pfam00910 ) RNA helicase
  • ( pfam00485 ) Phosphoribulokinase / Uridine kinase family
  • ( pfam13173 ) AAA domain
  • ( pfam00437 ) Type II/IV secretion system protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012628309.997093137033517e-262hypothetical protein
SGDYPL217C7.997650503635949e-84BMS1 SGDID:S000006138, Chr XVI
from 143171-139620, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17672.0.g106(coding)
ATGAGCGAAGACTAAGAGCGTGTGACTTACCGTATAGAACAATAAAGTGAGTCCTTTGAG
GAAGATTTGGCTCCTCCTTTCGTCATTGTCGTTCAAGGATCCAAAGAAAGTGGAAAGACC
ACTTTAATTAAGTCCCTCGTTTAGAATTTCACAAAATAAAAGATCACTGATGTAAAGGGA
ACCATTACTTTGAGAACGAATAAAAATCAAAGAATCACTTTTTATGAGTGCCCCACAGAC
ATGCAAGCCATGATTGATCTCGCAAAAATTGCAGACTTAGCATTGTTGTTAATTGATGCC
TCGATCGGTTTTGAAATGGAGACATTCGAATTCTTGTGTCTTTTGCATAATCATGGAATG
CCAAATGTAATGGGCATTTTGACTCATTTAGATTACTATAAACTTAACAAGCAACTTAGG
AAAACCAAGAAGAAAATGAAGAAGAGATTTTGGAAAGAAGTATACGATGGAGCAAAACTT
TTCTATTTATCCGGTTTGCAATCTGATGGAAATTATCCTCGCACTGAGATACACAATCTA
GGCAGATTCATTTCCATTTAAAAAATCAAGCCTCTCAGCTGGAGATAATCTCATTCCTAT
GTTGTTGCAGATAGATTTGATGTGATTGAATAAATGAATGACCCTACTTATAATACAGTA
TCATTCTTCGGTTATATCAGAGGTACTTATCTAGACAAGCATCAACGAATCCATGTGAAT
GGCTTGGGTGACTATGAAATCAAAAGCATCCAGAGAGTTGACGATCCCTGCCCCATAGAA
TTAAAGAAAACTGTTAAGTAAAAATAAGCCGAACATTAAGAAGAGAAATTAGGCACTTCC
AAAAAGAAGAAACGTAACTTGAAAGACAAGGAGAAAATCCTCTATGCACCATTCAGTAAC
ATTGGAGCAATGAACTTTGAAAAGACTTCAGGGTACATCACTATTCCAGATTAATACGTA
GTGTACACTAAGATAAATGAGGATGATGCAACAGGAACTTAGATGGGAGGAGTTGATAAC
ACTCAGCCAGGCAACGAGGGTCAATAGTTGGTTTGGAAACTGCAGGAAATGAATAAAGCC
ATGAATGAAAACGAAATAGAAGCTCCTTAATTGTTGAATGGTATAAACATTGCGGAGGAC
TCTGATGATGAAGTAGGAGGTAGAAACTGGAGACCAAAGTAATTGACTCAAAATGCTAAG
AAGTTTAAAGAGGATGAAAATGGAATATAGAGCAAGTTCGATGAACAGAGATTGAAGGAT
AAGCAAAGTCTTTACAGAGAAAAGGAAGTCGATAGTTTACAGTCTTTGATCTATGACCAA
GTTAACAAGGAAGAAGTTGAAGACTTCAACGATACAGAGTACGTTTTGGACACAAACAGA
TTCCAAGTAGCTCATGAAAAACTTACTCGCTATCTTATCCCAGATGTCAAGAAATTGCTG
AAATCTAAGTTCGTTACTGGCCAGAGTTAAGACTAAATCATGAAAAATCTGCTAGATATG
AGTGACAGTGATGAAGAAGAGAAAGCTGATGCTAAGAAGCTTATGAAAATGAAAAAGAGA
GGTTAAACTATTGATGATTCATCAGAAGAAGAAGCTTCAGATAATGATGACGACGATGAT
GATGAAGAGGGTGGAAACGTTTAAGATGACGGCAGAAAAAAGAAAAAGAAGAGTCACAAA
GATCCCACAATAGCAGCCAAATAAGAAGAAGATAAGAAAAACAAAGAAGACAAGGAGAAG
AAACTTTCTCTTTTCTTAGGTGAAAGTCATGGCCATTATAAGATGGGTGTTTTCGTGAGA
ATAGAACTTTAAATTTAAAAGAGCTTTTCTAGATCCCTAGTACCTGAATACCCAGTAGTA
CTTTGCTCATTAAGGTCTTAGGAGCTGAGTTATGCTTATATTAGAGTTAAGATAAAGAAG
CATAGATGGTACCCACATATTATGAAAAATAAAGATCCCCTCGTTTTCTCAATAGGATGG
AGAAAATTCTAGACTGTACCGGTTTATTGCATGGAAGATGAAAATGAAAGAATGAGAATG
GTGAAGTACACCCCTAAATTTGGATATTGCTATGCCATTTTCTATGGCCCAACTTATGCT
GTAGGCACAACTTTTATTGGTGTACAAAAACTTTAAGATGAAACAGGCAACGATGTAGCT
CATTTCCGTATCTGCACCACAGGAGTAGTAGTCGAGATGAATACTCAATTTAAGGTTATG
AAGAAACTCAAACTTATTGGTGAGCCTTTTAAGATACACAAAAACACAGCCTTTATCAAG
GGAATGTTTAATTCAAAGCTTGAAGTGGCAAAATTCCAAGGTGCTCAAATTCGTACAGTA
TCTGGTATTAGAGGTTAAATCAAGAAAGTTGTTAAGGAAAACGCTCCTGAAGGGAGTTTC
AGAGCTACCTTCGAAGATAAAATACTTAAGAGTGATATGGTCTTCTGCAGAACTTGGTAT
CAAGTAGAGATTCCTAAATTCTGCAACCCAGTAATATTCTATGGAAAATCTAGAATGTTA
AAAACACATGCTGAGCTAAGACACGAACGCAACTTGCCAATCCCCTCTAAAGGCTAAGAT
TCAGAATATATCAAGCATGACGAAGAAATCGATAGAGAACGTGACGAGAGAGTCTTTGCC
CCTATTTAAGTTCCTAAGGGTATAGAATCTAACTTACCTTTCAAGTCTAAATAGAAAGTT
AAGGTAGTAAATGACTAGGCTTAAGTCGATAGTCGCAGAAAGACCAATCTCTTGGAGGCT
TTGAATTTACCCACTAAGAGACCATTCAAGAAAATGTTCATGAATGAGTAGGAAAAGAAA
ATACATAGTATGGTTCAAAGATTGGCTCATCTAGGTAAAGAATACGAGAAGGATAGAAAG
GAGAAGAAAATCAAGCATGTTGAAGGCGTCAAGAAGCGTGTTGCAAAGATGAGTGAAAAG
AGAGAAGAGATGAATAAAGAAATTAGGAAGAAGAGGTATTAGAAGAATAGCAGAACTGCT
GGATCTAAAGGAGGAGATCATGAATGA


>Contig17672.0.g106(protein)
MSEDQERVTYRIEQQSESFEEDLAPPFVIVVQGSKESGKTTLIKSLVQNFTKQKITDVKG
TITLRTNKNQRITFYECPTDMQAMIDLAKIADLALLLIDASIGFEMETFEFLCLLHNHGM
PNVMGILTHLDYYKLNKQLRKTKKKMKKRFWKEVYDGAKLFYLSGLQSDGNYPRTEIHNL
GRFISIQKIKPLSWRQSHSYVVADRFDVIEQMNDPTYNTVSFFGYIRGTYLDKHQRIHVN
GLGDYEIKSIQRVDDPCPIELKKTVKQKQAEHQEEKLGTSKKKKRNLKDKEKILYAPFSN
IGAMNFEKTSGYITIPDQYVVYTKINEDDATGTQMGGVDNTQPGNEGQQLVWKLQEMNKA
MNENEIEAPQLLNGINIAEDSDDEVGGRNWRPKQLTQNAKKFKEDENGIQSKFDEQRLKD
KQSLYREKEVDSLQSLIYDQVNKEEVEDFNDTEYVLDTNRFQVAHEKLTRYLIPDVKKLL
KSKFVTGQSQDQIMKNLLDMSDSDEEEKADAKKLMKMKKRGQTIDDSSEEEASDNDDDDD
DEEGGNVQDDGRKKKKKSHKDPTIAAKQEEDKKNKEDKEKKLSLFLGESHGHYKMGVFVR
IELQIQKSFSRSLVPEYPVVLCSLRSQELSYAYIRVKIKKHRWYPHIMKNKDPLVFSIGW
RKFQTVPVYCMEDENERMRMVKYTPKFGYCYAIFYGPTYAVGTTFIGVQKLQDETGNDVA
HFRICTTGVVVEMNTQFKVMKKLKLIGEPFKIHKNTAFIKGMFNSKLEVAKFQGAQIRTV
SGIRGQIKKVVKENAPEGSFRATFEDKILKSDMVFCRTWYQVEIPKFCNPVIFYGKSRML
KTHAELRHERNLPIPSKGQDSEYIKHDEEIDRERDERVFAPIQVPKGIESNLPFKSKQKV
KVVNDQAQVDSRRKTNLLEALNLPTKRPFKKMFMNEQEKKIHSMVQRLAHLGKEYEKDRK
EKKIKHVEGVKKRVAKMSEKREEMNKEIRKKRYQKNSRTAGSKGGDHE