Identifiers and Description

Gene Model Identifier

Contig18635.0.g5

Standard Name

BMI1c

Aliases

Contig18635_0_g5

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004883600.0000000000019997478866288316DNA-binding protein Mel-18, RI
NG finger protein
SGDYOL054W0.0007003012208360162PSH1 SGDID:S000005415, Chr XV
from 228614-229834, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18635.0.g5(coding)
ATGAGTGATTCAGATAATTAACAACAAGACTTGAAAACTGGCTATATGTGCTTTGTACAA
ATGAAAAAACCAGTTTTGGATTAAATGTACCCAAATTTGACAAACTAGGAGTTAGCTAAG
ATGATCTGTGAGGAATGGGTATAGATAGGGCAAGTGGGTAGACAACCATATGCTGAAGAA
GAATTAAAAATGATTCAAGAGTAGAAAAGATAACAAGATCAAGTTCACTACTAAGAAAAT
GGGAAATTGCAAGATGGTCAAAACTTTTAGTAGAATAATCAAGTGAATAGCTATGAATAG
TCTCAAAATGGAAATCCTTCAGAAAAGCTTGATTGTAATTAAGACATGGAAATGGAGTAG
CAATAATAAGTGAACGGTCACTATTAGCCAAATATTATTAGGAATCAAGAATCAGGAGAA
ATTGAAGATTAAGAACAAAACCACGAAGGTCAGTAGGACGAGACAATAAAGATAGATCAG
GAACTCTTGAATTATGGACCTTTTAGATTATTCGTGGAACAGTATCATGATTAGGTGAGA
TAAGCTTATCCACAAAGCAGTTAAGAGCAGTTATTCCAGCTTTTCTAAACTTAATGGAAC
TAACTTGAATAAAATCAGAAAGATAACTATACACAGCAATATGCATAACTCGAGAAGCAA
CATAACGATCAAGTAAAGAATGAATAGATTTGTGAATCTCCTTCTTAAAACAACAATTAG
AAGACTTAAAATATTGCTAAAAGTGACTAAATGAATCAAATAATACCTTAAGCTCTAAAT
GGATTAAATTAGCTAAATTCAGGAGTAGTAGTTAGTAATGTCTCAGATAGAGGCAAAAAA
GAGTCTAAGTAACAATTAGATGCAAGATGTTTATTCTCTCAGTAAATGCAACAAGCCGTG
AAGCAGAGCTTTCCACAGATTCAGATACAAGACTTAACAAATATAGTAATGATAGCTTGG
AGAAAACTTCCTTAATTATACAAAGATCGATTTGTGAATCAAGCAGTGAGATAGAATGAT
GAATCAAGACAAGTTAAGGCAATGCAAGAATCTAAGTATATGCAGAAAAAGAAACTTAAA
GAAATGGGAGTACTGACTAATCAAGTAAATGGTGCGGCAAATTTATCTGTCCCAGGATTG
CCTAATCTTGCTTAAATTAACCTTCCTGTTACTCCAACAAAAAGTAGAACTAGATAGAAA
AAAGGCTTGAATACTTAAATACCAGGCTTATAACAAGCAACATTCAATAATGGAATTATG
AATCCAGCCCTTAATAATGGATTTCAGCAATACAATCCCCTACAAAATCCCCTCTTACTT
CCATTGCAAAAGAAAGCACCCTAGCAAGATGAATTGACTAAAATCCTTCAAATATATCAG
CAAAATCAGCTACTTTGTAGTCAGCTTTTGATGCAAGCTTAGATTCCCAGCTTGTACGCA
ATGAATCCAGCATTAAGCGGTCTTGTAGGACTCGCTAATCCTCTTTAAGCATAAACCAGC
AATGATCTTGCCAAAGCCCAAATGTAGCAGTTGCAAAAGAATTAGCTTTAACTTTAACAA
ATTGCTGCAAATTAACTTAACCCTGAAAACTTGCAATTCTAAAGATTACTAAGAAGCGGA
GAACCCACAAAAGCTGATATGCTACAATACTTGACTTGCTGGTTATGCAAAGGAGTGTAC
AGAGATGCCCACACAATTAATGAATGCATGTGCACTTACTGCAAAGGCTGCGTGTTTAAA
TACTACAGTGACAATCCAACCAGATATAAATGTCCCCAGTGTCAATCTGAACTCGGTGGA
AAACCTTTGGAAACTGTTGTTAAGGATTAAGTTCTCTAAAACATCGTTGACTCCTTAATC
CCTGACTTCAAATAGAGAGATGATAAACTTAAATCCTTGCTGCTTAAAAGCTTGATTGAG
AAGAGAATTAGTAAGGGCACCTATATTCCTAGAGGCAGAAAGCCAATTGTTCAGTAAACT
GATTAGATTGATCCATCTGAGTAGCCTGAAATTAGCAAAGATGTAACAATGACAGATGAA
ACTTCACAAAATTCTTAGACTAAGGAGAAGGAAAAGAAAGATAAGAAAGAAGCAATGCTA
AACTCCCCAGAAATGGAGTTCAAGTTAGTCCCTTAACATGAAGACGATGAGCTTTTAAGA
TTGCCAGAGCTACCAAAGAAACTCAAGATTGCAAAGAAAAACAAGACGATATTGTGTGTT
AAGAGACATATTAACAAGCTTTTGGGTGAGGCTATTGATAACATTGAGATATTGTGCAAG
AACTTCCCAGTTGCAGACTCGCATTCACTTGAGTACATCAGAAGAACTAAGTGGCAGAAC
AATTCCAAGACCATAGTCTTACAGTACAAGAGAAAGAAGAAGATTACCAATAACAGCAGA
TAAGAGATTTGA


>Contig18635.0.g5(protein)
MSDSDNQQQDLKTGYMCFVQMKKPVLDQMYPNLTNQELAKMICEEWVQIGQVGRQPYAEE
ELKMIQEQKRQQDQVHYQENGKLQDGQNFQQNNQVNSYEQSQNGNPSEKLDCNQDMEMEQ
QQQVNGHYQPNIIRNQESGEIEDQEQNHEGQQDETIKIDQELLNYGPFRLFVEQYHDQVR
QAYPQSSQEQLFQLFQTQWNQLEQNQKDNYTQQYAQLEKQHNDQVKNEQICESPSQNNNQ
KTQNIAKSDQMNQIIPQALNGLNQLNSGVVVSNVSDRGKKESKQQLDARCLFSQQMQQAV
KQSFPQIQIQDLTNIVMIAWRKLPQLYKDRFVNQAVRQNDESRQVKAMQESKYMQKKKLK
EMGVLTNQVNGAANLSVPGLPNLAQINLPVTPTKSRTRQKKGLNTQIPGLQQATFNNGIM
NPALNNGFQQYNPLQNPLLLPLQKKAPQQDELTKILQIYQQNQLLCSQLLMQAQIPSLYA
MNPALSGLVGLANPLQAQTSNDLAKAQMQQLQKNQLQLQQIAANQLNPENLQFQRLLRSG
EPTKADMLQYLTCWLCKGVYRDAHTINECMCTYCKGCVFKYYSDNPTRYKCPQCQSELGG
KPLETVVKDQVLQNIVDSLIPDFKQRDDKLKSLLLKSLIEKRISKGTYIPRGRKPIVQQT
DQIDPSEQPEISKDVTMTDETSQNSQTKEKEKKDKKEAMLNSPEMEFKLVPQHEDDELLR
LPELPKKLKIAKKNKTILCVKRHINKLLGEAIDNIEILCKNFPVADSHSLEYIRRTKWQN
NSKTIVLQYKRKKKITNNSRQEI