Identifiers and Description

Gene Model Identifier

Contig6635.0.g29

Standard Name

BMI1b

Aliases

Contig6635_0_g29

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam04547 ) Calcium-activated chloride channel
  • ( pfam13821 ) Domain of unknown function (DUF4187)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004883609.997764199084386e-16DNA-binding protein Mel-18, RI
NG finger protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6635.0.g29(coding)
ATGGATCAAAGATACCAAACTAAGTGTTCTGTACCTAGAAGTACTTTTGTGAAAGATTTG
ACTTGCTTTTTGTGCAAAGGACTTTACAGAGAAGCTCACACTTTGAATGAATGCATGTGC
ACTTTCTGCAAGATTTGCGCTTTTGAGTATTTTTCTGTAAAGGAGAACAGTAGAAAATGC
CCAAAGTGCTGCTAAGAAATTCGTGGAAGAGTCTTTGAGCAAATTGTGAAGGACAATACT
ATGTAGACTGTTACTGATTTAATCTTCCCAGAGTTCAAACAAAGAGAAGATGCACTTAGA
GCAAAGCTCTTGGAAGAATTCAACTAGAGAAGAATTAAATCTCAATAGAACTAGCAAATT
ATGCAAAATGCAGGCAATTCTGATCAGAAAAATTCAAGCACTTCACACATAGCCAACTTC
TCTTAAGTAATGAAGAGTGACTCCTCTACCACATCTTCAAGTCATATCACCCATACAGAA
GTTTAGCCTCAACTACAGATTGATGAAATAAACTTTGAATTCAAGCTTTTGCCCTTCAAC
GATGATGACCAACATCTAGTTCTTGAGAAGCTCCCCAAAACCTTAAAATACTCCAACAAG
AACAAGAATATGTTGACTTTGAAGAAGCACATCCACATGTATCTTGGAGAGCCAGTAGAC
AACATTGAAATTTTATGCAAGAACTTCCCCTGTGCTGACTCCCATTCTCTTGAGTATGTG
AAGAAAACTAAATGGCAGAGCAGCATGAAAGTGATGGAGCTCATGTACAAGCGCAAAACC
AGACCTGCTGGCATTAAGGATGAGTTTGCTGCTTCTAAAAAGTATAAATTTGAAGTTGAT
GAAATTGAAATTTGA


>Contig6635.0.g29(protein)
MDQRYQTKCSVPRSTFVKDLTCFLCKGLYREAHTLNECMCTFCKICAFEYFSVKENSRKC
PKCCQEIRGRVFEQIVKDNTMQTVTDLIFPEFKQREDALRAKLLEEFNQRRIKSQQNQQI
MQNAGNSDQKNSSTSHIANFSQVMKSDSSTTSSSHITHTEVQPQLQIDEINFEFKLLPFN
DDDQHLVLEKLPKTLKYSNKNKNMLTLKKHIHMYLGEPVDNIEILCKNFPCADSHSLEYV
KKTKWQSSMKVMELMYKRKTRPAGIKDEFAASKKYKFEVDEIEI