Identifiers and Description

Gene Model Identifier

Contig8932.0.1.g108

Standard Name

BMI1a

Aliases

Contig8932_0_1_g108

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam04547 ) Calcium-activated chloride channel
  • ( pfam13639 ) Ring finger domain
  • ( pfam12386 ) Pseudomurein endo-isopeptidase Pei
  • ( pfam13482 ) RNase H superfamily
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam09599 ) Salmonella-Shigella invasin protein C (IpaC SipC)
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam06906 ) Protein of unknown function (DUF1272)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12709 ) Central kinetochore-associated
  • ( pfam13453 ) Transcription factor zinc-finger
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam12773 ) Double zinc ribbon

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004883609.995317835403734e-19DNA-binding protein Mel-18, RI
NG finger protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8932.0.1.g108(coding)
ATGCAACACTTAGGTAATTCTGGAGAAGCCGCTTTTATCAGAAAAATAAAAAAGAGAGAT
CTGCATTCTTACTTGAAATGCCCACTTTGCACTGGGTTCTTCAGGGATGCACATACTATC
AATGAATGTTTAGACACGTTCTGCAAAAGCTGTATTTACAAATATTTCTATGAAGATTAG
AATAAGGAAAACTGTCCTAAGTGTAATATTCATCTAGGTGGTCGACCTCTTGAGACTATA
ATTTCTGATTAAACTATTCAAAAAATCGTAGATTTGTTGTACCCATAATTTAAAAAGAAA
GATGAGCAAGCAATTAAAATGATGTACTAAGCATTTGCAAGCACAGATCCCTTGCCCAAA
GATAGAAACCTAATAGACTATGGATTCGAGGACTATGATCTGACTGCTATAAATGATAAC
ATAGATCTATAAAATCAAAATGAAGACCAGCAGAAAGTTGAAAAATAATCATAAAATTAA
TCTCAGATATTGAGTTAGCAGTCTGTAGGGGCGGGTAATATTGCACAGGCTAGTAGCTAA
AAAAGTGTTAATGAAGCTAAATAAATTGGGAGTTAACAATGA


>Contig8932.0.1.g108(protein)
MQHLGNSGEAAFIRKIKKRDLHSYLKCPLCTGFFRDAHTINECLDTFCKSCIYKYFYEDQ
NKENCPKCNIHLGGRPLETIISDQTIQKIVDLLYPQFKKKDEQAIKMMYQAFASTDPLPK
DRNLIDYGFEDYDLTAINDNIDLQNQNEDQQKVEKQSQNQSQILSQQSVGAGNIAQASSQ
KSVNEAKQIGSQQ