Identifiers and Description

Gene Model Identifier

Contig934.0.g27

Standard Name

BFARb

Aliases

Contig934_0_g27

Description

YEATS family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03366 ) YEATS family
  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam03854 ) P-11 zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002482103.999374135750469e-31YEATS family protein
SGDYNL107W0.00000000030007160092483236YAF9 SGDID:S000005051, Chr XIV
from 420098-420778, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig934.0.g27(coding)
ATGGTCGAACCTTGCACTTTACCCTGCAACCATGTTTTCTGCATTTAATGTATCAATCAA
TTAGTGCAATAAAAAACTTAATGTCCAATGTGCAGATTTGATTTTCCAATTGACTACAAC
CCTTAAGTGGACTTGAAATTGCAAGCGAAGATTTTAAGTTAAAATGAAATCAAATTTAAG
GAAAGACTTGAAGAACTGAAGACGCAAGGGCTACTTGAAGGGAACTAAATAAGAATAAAG
TTTATCTATGGAAATGATCATAAACCTGTACAAAATCCTAAGAAAGTTGGCTAAGATAAT
TATAATGCGAATGAATGGACTACTTTTGTCAGATTAGTTCCAAATTAAGGATTAAATTCC
AATGACTCAATTAAGAGGTATATATAGAAAGTAAGATTTGGCCTGCATCCAACATTTGGA
GTCACTGAGATAGATGTAAAATCAGCCCCTTTCTAAATGACCAGAATTGGATGGGGTGTT
TTTAATATACCAATTGAAATATTCTTTAGAAGGGATACTGGCAAAAAAGAAACTATAAAA
CTTGATCATTATCTTAGTTTTCAAGGTTAAGGCTCTTCAAGAATATTTACAATTGCATTC
GATAAGGAGAAGTTAGATTAAATTTCATATCTTTGA


>Contig934.0.g27(protein)
MVEPCTLPCNHVFCIQCINQLVQQKTQCPMCRFDFPIDYNPQVDLKLQAKILSQNEIKFK
ERLEELKTQGLLEGNQIRIKFIYGNDHKPVQNPKKVGQDNYNANEWTTFVRLVPNQGLNS
NDSIKRYIQKVRFGLHPTFGVTEIDVKSAPFQMTRIGWGVFNIPIEIFFRRDTGKKETIK
LDHYLSFQGQGSSRIFTIAFDKEKLDQISYL