Identifiers and Description

Gene Model Identifier

Contig7200.0.g69

Standard Name

BFARa

Aliases

Contig7200_0_g69

Description

YEATS family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03366 ) YEATS family
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13639 ) Ring finger domain
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam04564 ) U-box domain
  • ( pfam14447 ) Prokaryotic RING finger family 4
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam14353 ) CpXC protein
  • ( pfam14319 ) Transposase zinc-binding domain
  • ( pfam07191 ) Protein of unknown function (DUF1407)
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam02891 ) MIZ/SP-RING zinc finger
  • ( pfam08209 ) Sgf11 (transcriptional regulation protein)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002482101.9991517704232713e-32YEATS family protein
SGDYOR213C0.000000030002053728821195SAS5 SGDID:S000005739, Chr XV
from 745281-744535, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7200.0.g69(coding)
ATGGAACGAAAATAAAATCTACCTCAAAAACCTGTACCCTAATAAAAAGTAACAGCTTCT
GCTGGATCTACAACAGGAGGAACGGTCAAAAAGGGAAAAGATGACTTTGAATGTCCTATA
TGCCTTGAGATAATTGCTGAGCCTGTAATGACTCCTTGCAAACATCTGTTTTGCTTATCA
TGTCAGAAGCAAGTCCTTCAATTAAACGCTACTTGTCCAATGTGCAGAAGATAATTCGAT
GAATAATTTGTGCCAAAAATAGACTTAGACACTCAAAAATAAATTGAGCAGATGTTCCCT
TAGGACTTTGAAGAAAGGAAAGAGTAACTGATAAAAGCTGGGCTATGGAGAGGCTCAAAA
TTTCCTATTAGATTTACTTTTGGAAATTTGCATAGTGATATTAAGAACCCGAAAGTTTCT
AATAGCGATAAACAACAACGTAACAGTCACAGATGGATCATGTTTGTAGCTTTAGCTAAC
GATCCAAATAAAGATAAAGTAGGCAAATTCATAAAAAGCGTTACATATCATCTACATCCA
ACTTTCAAACCAAGCGTGGTAAAAGTTTCATAAGCACCATTCTTGATATCTCGTATTGGC
TGGGGTTATTTTGAGATTCACCTGGAAATCGAGTTCAAGAAATGGACTGGTATACCCAAA
ATGGAACTTGATCACATGCTGTGCTTTGAAGATAATGGAAAGCAAGAGGGATTCATTATT
GAATTAGAAAGAGAAGAGCCTCCTGAAGAAGATGAAGTTTCTTAATTGACAAATAACTTT
GCCAAAAAATTAAATATAAAACCTCAAAAAAATGGCCGGGAGTCAGATTGA


>Contig7200.0.g69(protein)
MERKQNLPQKPVPQQKVTASAGSTTGGTVKKGKDDFECPICLEIIAEPVMTPCKHLFCLS
CQKQVLQLNATCPMCRRQFDEQFVPKIDLDTQKQIEQMFPQDFEERKEQLIKAGLWRGSK
FPIRFTFGNLHSDIKNPKVSNSDKQQRNSHRWIMFVALANDPNKDKVGKFIKSVTYHLHP
TFKPSVVKVSQAPFLISRIGWGYFEIHLEIEFKKWTGIPKMELDHMLCFEDNGKQEGFII
ELEREEPPEEDEVSQLTNNFAKKLNIKPQKNGRESD