Identifiers and Description

Gene Model Identifier

Contig17931.0.g49

Standard Name

BDBP1

Aliases

Contig17931_0_g49

Description

Bacterial DNA-binding protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17931.0.g49(coding)
ATGAACATAAGCGAAAGCATGTAACTATTCTCACAATAACATCAAATCTAATAATTAAAT
TCCTTAGATTAATGCTTAAAGAGTAACCACTCAACAGCAACCATCTAAAATCCTTTTAGT
TTCAGCAGTTTCTCCATAATTCCAGATGCTTCTAGTAATCTAAATTCTGGTGCTGCCAAT
TCAAGTGTTATTCAAGATTAATTGAACAATAACTACGATTTAACAAGCCTACTGTAGTAA
AATAACACAAGTTCACTACCCTTATAATAGTAAAACAACAATAACTATTACAGAAACCAA
TATAATTCTCAATTTCATTCTTAGCACTCTCAACTTTAGCAGTAAAATCAAGCATACATA
GACCCATAGCAACAAGTGGACAATGAAATCTTGGAAAGTCTTATAACCTAAAAGTTGACT
TCTTAAAATAGCATCCCAGTACTATCAGACACCCTCCAAAAAGTGTAAAACTCACAATTC
AAGGCAAAGTAGCAAATTTTAAGTGAAAGTTTGAACAGTTAATTTAAAGACATGATAGAA
GCTCTTTACAGATAAATTGAAATTTAAGAGTGGGATAGTCAGTAAATTATTGATTAAATG
ACTCAAAGCAATCATTTAATACTGCAAGAAGCTTATTAGAGCTATGAAAATAGTCAGAAT
CAGTATAATAACAATGGTATTATTAATAATAATAACGAGGAACATGGGCATGCTCTTTAG
CTTATAAATGCCATGAATTAGAATATTTCATAGAGTCAGCAATCAATAGAGACTATGATG
GATGAAATCTTTGATAAAATTACTAATGCTATATAGTATTCTGTGTAGAGTATTGCTTCA
CAGGTCATTAATGATTAAACTAAAGAACTCTACTTAAATGATAGTGGCAATCAAAATGGA
TGCATAGGTAATGGCTTTAAAAACAAATCAGTTGAATTAGCCTATAGTTCAACAAAGTTT
AGTATTGTAATTGGACCCTGA


>Contig17931.0.g49(protein)
MNISESMQLFSQQHQIQQLNSLDQCLKSNHSTATIQNPFSFSSFSIIPDASSNLNSGAAN
SSVIQDQLNNNYDLTSLLQQNNTSSLPLQQQNNNNYYRNQYNSQFHSQHSQLQQQNQAYI
DPQQQVDNEILESLITQKLTSQNSIPVLSDTLQKVQNSQFKAKQQILSESLNSQFKDMIE
ALYRQIEIQEWDSQQIIDQMTQSNHLILQEAYQSYENSQNQYNNNGIINNNNEEHGHALQ
LINAMNQNISQSQQSIETMMDEIFDKITNAIQYSVQSIASQVINDQTKELYLNDSGNQNG
CIGNGFKNKSVELAYSSTKFSIVIGP