Identifiers and Description

Gene Model Identifier

Contig7317.0.g32

Standard Name

BCD1b

Aliases

Contig7317_0_g32

Description

HIT zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000438100.00000008001913847069386HIT zinc finger family protein
SGDYHR040W0.000009999254677478949BCD1 SGDID:S000001082, Chr VII
I from 187924-189024, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7317.0.g32(coding)
ATGTCCAAAACTTTCACAAAGTCATACTTTCTTAACAATGAGCCAGAATACCTCTCAGAT
CAAGATTAATAAACTAAAGAATAAACAATCAAACCAATTTGTTAAATCTGTTCATAAAAT
CCTCATAAATATAAATGCCCTGGTTGTGATAGATTAACATGCTCTCTTGCTTGCATTAAT
AAACATAAGCAATAATACAAGTGTGATGGTAAAAAATCTACACAATCATAGTAACTGATT
AGACTTGCTGATTTTGGACTCAATCATCTCAAAAGAGATATGAATTTCATATAAGAAGCT
ATTTCACAATCAAACTCTGTGAAGAAATCAACCTTTGAAGCTCAAGTAGATTCCAAAGTA
CCCAAGCGCATTAAGAATTTAAGGTATTTCCTGAAGAAAAAACGTGGAATTATTTATAAA
CAAGCCCCTAGATAGCTTGCTCATCTTCGTCAAAGACTAAGATTAAAAAACTAAGTAACT
ACTGGAGTAGTAACAAAACATCTTAAGTATTCTTGGTGGTCCCAGTCCCTAGAAATCTGA


>Contig7317.0.g32(protein)
MSKTFTKSYFLNNEPEYLSDQDQQTKEQTIKPICQICSQNPHKYKCPGCDRLTCSLACIN
KHKQQYKCDGKKSTQSQQLIRLADFGLNHLKRDMNFIQEAISQSNSVKKSTFEAQVDSKV
PKRIKNLRYFLKKKRGIIYKQAPRQLAHLRQRLRLKNQVTTGVVTKHLKYSWWSQSLEI