Identifiers and Description

Gene Model Identifier

Contig4408.0.g105

Standard Name

BCD1a

Aliases

Contig4408_0_g105

Description

Baculovirus LEF-11 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4408.0.g105(coding)
ATGAATTTCATATAAGAAGCTATTTCACAATCAAACTCTGTGAAGAAATCAACCTTTGAA
GCTCAAGTAGATTCCAAAGTACCCAAGCGCATTAAGAATTTAAGGTATTTCCTGAAGAAA
AAACGTGGAATTATTTATAAACAAGCCCCTAGATAGCTTGGTAAGAGCAAGCACAACACC
ACTAATTTAGAGAGTGACTCAGCATAAAACGGACAGAAGTTTATTAAATGGACTGTTGAA
CTCATTTTCGTCAAAGACTAAGATTAAAAAACTAAGTAACTCCTAGAGTAGCAACAAAAC
ATATTGAGTATATTAGGAGGACCCAGTCCCTAAAAATCTGAACTTATAGAAGAACCAAGT
GTCTTGGAACTGCCATAAATCTCAAGAATTATACTTAATGAGGAAGACATGATACATGAA
GAGACTACACTTTAAGCTTTCATTAATAAAGAGCATCTCAAGATGAAATATCACAATGAA
TAATTCAATTTGTTTATTACTAATGTGGATGGAGACATCATTAAAAATTCAACTGTCTTT
ATGAAGAGGATTGAGTAAAAAGAAGCAGAACATGAAGAAGGTGAAATTTCAGATGACCCA
CAAGATTAACTTCTTGATAATAATTAAAACCCTTAAAATCTCTTAGATCAATAGGACACT
AAACATTTAAGAGCAGTCTTCAGAGAATTGGATAAAAGCTAGAAATTGTTGGAAGTACTA
AGAGGCAATATTGTGTACGAATACCCTACTTTTTATGTTAAAATCAATTAATCATGA


>Contig4408.0.g105(protein)
MNFIQEAISQSNSVKKSTFEAQVDSKVPKRIKNLRYFLKKKRGIIYKQAPRQLGKSKHNT
TNLESDSAQNGQKFIKWTVELIFVKDQDQKTKQLLEQQQNILSILGGPSPQKSELIEEPS
VLELPQISRIILNEEDMIHEETTLQAFINKEHLKMKYHNEQFNLFITNVDGDIIKNSTVF
MKRIEQKEAEHEEGEISDDPQDQLLDNNQNPQNLLDQQDTKHLRAVFRELDKSQKLLEVL
RGNIVYEYPTFYVKINQS