Identifiers and Description

Gene Model Identifier

Contig6565.0.g83

Standard Name

BAZL

Aliases

Contig6565_0_g83

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

Biological Process

Domains

  • ( pfam00628 ) PHD-finger
  • ( pfam12998 ) Inhibitor of growth proteins N-terminal histone-binding
  • ( pfam13771 ) PHD-like zinc-binding domain
  • ( pfam13832 ) PHD-zinc-finger like domain
  • ( pfam11180 ) Protein of unknown function (DUF2968)
  • ( pfam01496 ) V-type ATPase 116kDa subunit family
  • ( pfam14446 ) Prokaryotic RING finger family 1
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)
  • ( pfam13831 ) PHD-finger
  • ( pfam13639 ) Ring finger domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002868100.000019995566179747357PHD-finger family protein
SGDYMR075W0.00003998524687536623RCO1 SGDID:S000004680, Chr XII
I from 413982-416036, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6565.0.g83(coding)
ATGTCAGTAATACCAGAATTATTTGAAAACTACGATCATATCCCCAATGAATTCAAGAGA
CACTTGTTGCTAATTAGAGAGCTAGATGAATTCTAAACCAGTTTGGAATCAGAACGTGAA
GCTCTGAAGAAAGAACTTTAAAAGAAATCAGTAATCGAGGATGAAGAGCAACGCACTAGA
ATGATAGACCGTCTCACTCAAATCTACACTAAAATAGACAGTTTATCTGATGAAAAAATG
GAGATCACGGCAAAGCTATTTTCTATGCAGGAGAATTTTATCAGAAAGTTGGATTAACAA
ATTGAGAAGACAGAGGAAGACAAAAATGTGTAGGATAAATGCAGTTAAGACTAGGCTATG
GACGATACTGAATTAGGGCAACCTATTGCAAGCAAACATAATATCAAGAAGAAACCAATG
CTTCCTCCAGGCAGAGGAGGGTATCCAACCAGCACATTCAGTAAAATTTAAAACGATACT
TTAAGCCAGAGTTTTGGAACAAGTTAAGAATTAGGCGGCACAAAAAGCCGAACCAAGAAC
GATCCATTTAAGTATGAAACTGGAAATCTCTCAACTTTGGGTTCCAAAATTAATAAGAGA
GATAAAATTAGAGACAAAAACAAGCCTTTCATGTCAAGTGCTGCAAACTTCGATTCAAAC
GCTTCATTTGGCTTCGGCAACACTTCCTCTTAAAAAAGAGTAAACAACAATGGCTTAGGC
AACACAAGTTTCGCTCCTTATCAATTCTCACAAGATGAGCCAATAATTGGAGGAGACCCC
ATTGAAAATGTAGAGGAAGACGGCCAATGCTCAGTTTGCAATACCAAGAAGCTGAATGAT
AACTGGATATGCTGTGATGCCTGCTAGAACTGGTTCCATTATTCATGTGTTGGAGTCAAT
CAATTCAATATGCCTAAGGAGGATGAGTCTTGGTTTTGCTCTTCATGCAAGAGAACACAA
AGTGGAGGGAATTCCTCAGGTTTGAAAAGAGGCTTCAGTGAGTTCGGAGGACCAAATATT
CTTGATGATGCATGA


>Contig6565.0.g83(protein)
MSVIPELFENYDHIPNEFKRHLLLIRELDEFQTSLESEREALKKELQKKSVIEDEEQRTR
MIDRLTQIYTKIDSLSDEKMEITAKLFSMQENFIRKLDQQIEKTEEDKNVQDKCSQDQAM
DDTELGQPIASKHNIKKKPMLPPGRGGYPTSTFSKIQNDTLSQSFGTSQELGGTKSRTKN
DPFKYETGNLSTLGSKINKRDKIRDKNKPFMSSAANFDSNASFGFGNTSSQKRVNNNGLG
NTSFAPYQFSQDEPIIGGDPIENVEEDGQCSVCNTKKLNDNWICCDACQNWFHYSCVGVN
QFNMPKEDESWFCSSCKRTQSGGNSSGLKRGFSEFGGPNILDDA