Identifiers and Description

Gene Model Identifier

Contig1146.1.g9

Standard Name

ATX2

Aliases

Contig1146_1_g9

Description

LsmAD domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR178C0.000000019990673443141236PBP1 SGDID:S000003410, Chr VII
from 853215-851047, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1146.1.g9(coding)
ATGACATCTACGTCGAGTTCAGGGTTTTTTGATAACAAAAAATCTAACAAGTCAGGGGCC
GGTAATCAAGGAAACTCCAACTAACAGCAATATAATTAATCTACTGGCCAATCTAGCAAT
TAAGCTGAAGGATGGGCAAACTTATTTCCAGGAGGTTAACCATCCCAATCAAAACAACAA
AACTAGCAGTAGAATAAAAGTGGTAAATACGCAAATAATAACTCGCAGCAAAACATTCCC
AATTCAAGAATGAACGCTAATTTGAAAACAGATGCACAAATAAGTTCATCAAATAGTACC
GGTAAACGCATGGAGCGCACTCTCCAGAAATTCAACTTTGGTGACACTAACAACACACTC
GCTAATTCTAATTCAAACACTCTCGCTTCTACTGGCGGACTTCATAGAAATTAAACATTG
AACAAGAGTTAAAGCGGGAATTAGTGGCGTCGAAACACCGTGACTGGTGGGGCACTAGGG
TCTCTTGAGGATGATGATGATGGCTAAGAGTTCAACTAATTCGCAGGTAAAAAGAGCACT
TACGATGAAAGTCTGTACACAACAAGAATAGATGAGAACAAGGTATCCCAAGACATAAAG
CAATACGCTTCACAGATGGAAAAGGAAATCTTGAATTCTTCAGCTGGAGGTAACAGACAC
ATTGCCGAAGAGAGAAACTAACTAGAATTGCAAGATAACGACATCCCAGATAAATATGCA
GAGGAGATGCTCTACAGTGGAGTTTACAGAAACAATAACAATGAATCATCTCAAAAAGCA
CCAACTCAGTAGTAGGCTAAGCAGAGTTAAGTGCAATAAAACATTCACACAAGTAGTGCA
GCTTCTGCAGCTGAATTCTTTGATAAAAGCCAGTCAAGTTAGCAACAATAGTTGAATAAA
TCATAAACTATGAGTAACTAATCACAACCTTTTGTACCTTCAGGAAAGGGCAAGAAGCAA
CAGCAACAGAATACTCAACAATAAGTATAAAACTAGCAATATCAATCTCAATATACTAAA
CAAGGAAAGAAATAAGGTCAGGGATAAACACAGAACAAAAGTGTGAAATTCATTCTGAGA
GATACCTCGAAAGAAAGGTAAAACGTTGTAGAAGAGATGATGAATACATTCATAGATAGA
AAGAAATAATTGCAACAATCTAAAGTTGAAAGTGTGGATAAAGCTGAAGATCCAATAAAG
ACTTTGATTGTTCCTTGGAAAGGTGACAAATAAATCAAAGCAGAATTACAACCAAAGAAT
AAAGACAGTAAAGTTGTAGTGGAGAAACAATAAAAATAACCAGAGCATGAAGTGGTTAAG
AAATAAGATATAGCACCAGTATAAGAAGAAAAAGTTCAAATCCAAACTGAGAATAAAGTC
TAGCAATAATCTCAGTATCTACCTTAATCCAATTTAGCAAATTAAGTAGGAGCTGCACTT
AATCTCAAAGCTACAGAGTTCAAGCCAATGAAGAAATCTCAACCAGTCATTGAGCAAACT
TAACAACAATAACCAGCTTTAAATTAATCTTAAAATCTGTCCCAAAGCACTATAATATAA
CCAACTCAAGATATCTAAAATCAACATTAACCAAGTTTATCACAATCTTAATTGATTGAC
ACTTCTTATACATCGACAGCTGATGTTACAGCATCCAGCATTGAAAACCCAGTGATTAAT
TCAATGGCTTAATAGCTTTAGTACAATATAGCAGACATTCAGCCATTCATTCCTAAAAAC
AAAAAAACATCAACTTCTTAAACTACCATCACTCCTACTATAAAAGTTGAGAAGAGTAAC
ATAGAGTCTTAGTAGGAACCATAAGCTATATAAGATTAAACTACAAATCCTGTGAATTTT
GTAGCATCAAATATCCCACAATAATAAAATGTTTAACAGATTTAACCCAGTCATTAAACT
TCACAACTCTAAACTTAATCACAAGCATTTGTACCTATGAAGAAAGCTCCAATTAATCCC
ATTGGGCAGTCACCCTATATGAACAATTAAATTGGCGGGAATCAGATGCATGGAGGAGGT
CATTACAGTGGCTAGGGAGGAGTGTACAACTAAAATGCTCAACACTTTGCGCCAAGCAAT
TAGTAATAAAACATGGGAGGCTATATGCCACAACACTAGTAATAGCAACATCCCCATCAT
AATCAACCAATGAATAATTACCCCTAGTACTATCCACTCCAGTAATAGCAGCAGAATTAA
CAATTTAATTCACAGAATAATGCTTCGTTAAACACTTAACTAAATAATGATACAGCATCA
TCAGAATTGTAAACATCAGCCACTCTCAACACGAACGGCACTAATCTCAATCCAACAGCA
AAACCATTTATTAAAAAGTAAAACTGA


>Contig1146.1.g9(protein)
MTSTSSSGFFDNKKSNKSGAGNQGNSNQQQYNQSTGQSSNQAEGWANLFPGGQPSQSKQQ
NQQQNKSGKYANNNSQQNIPNSRMNANLKTDAQISSSNSTGKRMERTLQKFNFGDTNNTL
ANSNSNTLASTGGLHRNQTLNKSQSGNQWRRNTVTGGALGSLEDDDDGQEFNQFAGKKST
YDESLYTTRIDENKVSQDIKQYASQMEKEILNSSAGGNRHIAEERNQLELQDNDIPDKYA
EEMLYSGVYRNNNNESSQKAPTQQQAKQSQVQQNIHTSSAASAAEFFDKSQSSQQQQLNK
SQTMSNQSQPFVPSGKGKKQQQQNTQQQVQNQQYQSQYTKQGKKQGQGQTQNKSVKFILR
DTSKERQNVVEEMMNTFIDRKKQLQQSKVESVDKAEDPIKTLIVPWKGDKQIKAELQPKN
KDSKVVVEKQQKQPEHEVVKKQDIAPVQEEKVQIQTENKVQQQSQYLPQSNLANQVGAAL
NLKATEFKPMKKSQPVIEQTQQQQPALNQSQNLSQSTIIQPTQDIQNQHQPSLSQSQLID
TSYTSTADVTASSIENPVINSMAQQLQYNIADIQPFIPKNKKTSTSQTTITPTIKVEKSN
IESQQEPQAIQDQTTNPVNFVASNIPQQQNVQQIQPSHQTSQLQTQSQAFVPMKKAPINP
IGQSPYMNNQIGGNQMHGGGHYSGQGGVYNQNAQHFAPSNQQQNMGGYMPQHQQQQHPHH
NQPMNNYPQYYPLQQQQQNQQFNSQNNASLNTQLNNDTASSELQTSATLNTNGTNLNPTA
KPFIKKQN