Identifiers and Description

Gene Model Identifier

Contig19156.0.g85

Standard Name

ATR

Aliases

Contig19156_0_g85

Description

Phosphatidylinositol 3- and 4-kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR136W5.002115178225629e-63MEC1 SGDID:S000000340, Chr II
from 505668-512774, Genom...
T. thermophilaTTHERM_001476102.000214949834694e-50Phosphatidylinositol 3- and 4-
kinase family p...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19156.0.g85(coding)
ATGGAATCTAAAAAGAACTCAGAATTTTCAGTTCATCAAGATATGGTAATGCAGGAACTC
ATTTACTACAAAGAGGAGCTAGATATATTCGGCTTGAATAATGAAAATCCAACTTTTGAC
ATTCAAAGATACGTAGACTTGAAAACTTTCATTCTAATGCTAAGCAGAAACAAGAGATCA
GTAGACATGGTTGAACATTTGTTGGCAGCGATATTTGTGGTCAGTGATGCAGATGGCCTC
ACAGATAAAAACAAGTTACTTGACTGTATAGTACAAAAGTTTAAACTTTTTGAGCTCTTG
AGCAAAGTTATAAGAGTCACTCCTTAAGAGCTACTAAGGTGTGCGTCAAGTCATATCTGT
GGAAAAATTACTTTCCTTCTAATGCTACACGGAAGCACAATTTCAGTTATTGACAAGTTT
ATCGGTGTATAGTTTTACAATCACTTCATCTTACCCAAGTCATGGTATTATTTGATCAGT
GTTCACAAGCTCACTTATGAAAAGCTCAAAGAAACCATCTTAAGCACTTAATTTAACAGC
AATACTATCTTAATTAGTGCGATAAGAGATCAGTTAATGCATTGTATTGGTAAAATAGCT
TTGTAACACAATTTGCAATCAAGTCAAAAGAAAAACTTACTTCAAATCATGAAAAATGCA
TTTGGTTTCTAAAATGACCAAGATATGATTTCTTTTATAAACGGTGAGAATGGTAAAGGG
TTATACTATGAAACTCAACTCTTATAGATTCTGATGAAAAAGCTTTCATTTGGTAGAAGA
TTCTAACTAGAAAAGCTAATGATAAAAGGAGACTAAGACAAGACTTTAGTTTTTTATGAC
AAGAAGTAGTACATGCAAACAGACTTTTACAACAAAAAAGGTGAATCAGTCAAAAAGAAA
ATTGCTCAATTCAAGTCTGCTTTAGAGTTCATTAGCAAAGAATTTAAGAAAACTAATGTC
ACAAATTCAGACTTTGTCATTGGATTCTTAGAGATGTTTAAAATTCAATTTCCTACATCC
TTAACAGACGCCAAAGATTCAATGACCAGGTAGAATAAGCTTATATAATATATAATGACA
GTAGAATTACTAATCAAGGAGTAGCTAGTTGAAGACCCATATTTTAGAACTGCCATTATA
GTAATGACTATCTTTGTATTAAAAATTGGAATTGAATACTAAGATACAGTTGAAATTGCT
ATTTTCTCTATGCAGTTGATTCTCAATGCTATTGGTTTACAATAAGCCCTTCCTTATTTG
AATAAGTTTTGCTCACTTGCAGTTTAAGCTTTCATCAAGTTTCCAGAAAAACTTAAGATA
AAGAAATACACTCAAAAGATCATCAATTTCTATATTAAAGATAAGATGAAGTTTACTTAA
GCATATTTCAAGGATTTACAGTACTTATTCTTAAGTAAAATAAAAGAAAACGAAGGGTTT
AAGGAGGCAATAAATCTTATTAGTTATGAACTATATAAGACTCCAGAAGATATTGCTGAA
AACTTAAAAAATCTTGTAAACTAATTACAAACTGGAAATGAAGATATTAGATTGCTTAAT
ACTACCTATATTCTGGAACTTCTTGAACAACAAGAACAAGATGAGGTTAGAAAAGTATTA
GTACTACCAGAAAATTTGAAAATTGTATATTAAGGAATACTTGAAATGCCTCAAGAGTAT
AAAACTGAAAAAAGTAGAAAACTTTCACTGCTATGTGCAAAAGTCGTTGCTGCGATAGGA
CTTTGTCAGCCATTTGTCAATGATCCACTCACTCTTAAAGCTACTAACTAGATGACATTA
ATAGGAAGAAAAAAGGAATTTGAAGTTCAAAATACTAGTGATGAATAGAACCCAAGTATC
ATAAAAAGCGACTATTACAATCCCTTAACTAACTTAAAGTACAAAAATTAGGAGCAAGAT
AATACTCTTGAATACTTAGCTGTACCTTCACTAAGCGAGTTACCTATTGAGAGAAAAGAT
ATCATTAAATTTGCTGGTTAACTTTTAAACTAGATCTAATATATAAGCAATATCACAGAC
TTAAAGCCTCAGCAATTCTACTATACTATATTTTTGATAGACAAATTTATTAATCATCAT
AAAATGTAGCAGGGTCTAGTAGAACCGAATGAAAGAGACCAACTAGAACAAACAATAAGC
AAGTAGGAACATTTTGCTAAAACAGTTTTTAAGTTTATTGGAAAAGATCTAACTCCTGTT
ACAGAAATTGATGACCCTAATTCATTAAGCAAGAAGAATTACATAAAGAATCTTTCCCTA
TACTTGATTCACAAAATTTAAGATGACACCTGGAAACAACTGTTCATTGCATGTATTCCA
GCATTAAAAATTAGTCACAAAGTTTTAGATCTTTTATTGCCTTATTTGATATATTACTCT
TTGAGATTCAACTAATAAGATTTGAGCTTGCCTGAAGATATTGGGAGACTTTTTAACAAA
ATTTATGACTCTAACTTCTCATCACAGATTGCCCCAACTCTCAAAGTATAAGATTTCTTA
AAAATTTGCTTAAACCAAGATAAGAAAATTTTCAAAACTTTTATTGAGAATGACACGAAG
TTTAAGTACGTAGAAAAGCTTTTCCACATAGAGTTTGATAGCTCAAAAATCAAAGATCAA
AATGTGCTAAACTTTATCAAGGTAATTGAAGGAAACATACATGTAAAATTGTCATTCCTT
GCAGTCAAAAAGATAAAGGCACTTATGTGCATGATTGACAAGTTAAAGAAGATTAATGCT
GCAAAAACTGTAAAAGCTTACCAGAGATGCATATATAGCTTCGAAGATCATTATAGAAGC
TAAATAAATCAAGCAGGAAACCAAGGTAAAGGGTTTTTGGATGTACTTTCACATGAAGAG
ACTTATGATATAATCAACTTAAACAAGCAGCTAAATCCTGAAGACTATGACTACGGTATC
TTCAATAATATTATTGAGAGCTACAACAACAATTAGGAAAAGCATCATAATGAAGAGTCA
CCTATGGAAGTAGAAAGCAATTTTATAGATTTAGAAGCTTAAAGGAACAAGCTTATTGCT
TAAAAGATTAAGAAGTTGTTCTCTAATCCCTTGATAATTAATGACTGGCATAACAATGAC
TGGGAGAAGCTTGAAGTATGGGCAAGTGACGTAGACTTGGGTGAGCTTAATCATAAAATC
ATAATGATAGACACTGAGTAAGGTGATCCACTATAGAAATTCGAAATGATTATATGCTTA
TTTGCGGCTGAGTACTCTAAATGTCTTAGAAGTCTTTTACAAAACGATGATAACTTAGAA
AATCCTGACTATTTAAGCAGCCTAGATAAGATTAGTAAATTCTTTGAATTGCTCTATTGT
GAGTTTATTCTTACTCTTGATGGCATTCAAGGTGAAATTAGTTACTACTACAAACTATTT
TTGCATGTAATTTACGAGCTTGAATCAGCAGTTCATTACATAAAAGATGTTTTCCTACAA
GAGAAGGATAAAATTTAGGAGATTCTTCGAAAAGAAGTCAACAGAGAAAAGAGAAGATTT
GAGAAAATTTACTATGAGTTCGACATGAATAACTACTTTGAAAAACTCCTATCATGGTTT
GAAGAAAGATCAATGATGATTCAAAATTCAACTTAATCTCTTAAGCTAATCTATTACTGC
AGACGAATGATATTCAAGTTATTTGACAGAGAGAATGAATATGCCTTTTACTTAATGAAA
CTTGCAAAAATTTAAAGGAAAACTAGCAATGATATCTTGCTTATCAGCAAGCTTTTCAAA
GAATGTGAATCAATGTAGCATAGAATTGTTGACTATGATTTGGAATACGCTAAGTACATG
CTAAAGACTAAAAATGCTCATGAAGCTTATCAATACCTTATATAAAAACAAGATCAAATA
TAGAAAAAGTGTGATGAAATGTACAAAACCACTAAATTCCAATGGATGCCTCAAAGAGTT
GCTGACAAGGCAACTCTACTAAGTATAGAATTACAGATAAAAATTGATCCTTAAAACCAT
AACATTCAAAAGAGGTTTGATGATTTCTTAAAGAGTATTGGAAAGAATTAATGGGAAAAA
CCAGTTTTTAGATTTGCTCAGTATCTTGATGAGTTAGACTTAAAGAATAATAGTTTACAA
AACCCTCCTTCACTTGACCCAACTGATGCAAGAAAGAGGTGGATTCAAAAAATCTTTTAC
TATGTAAACAGCTTAAAGTATGGATATAAGTATATTTGGCAAAGTTTCCCAAGAGCTTTG
GAACTATGGTTTGAATATAATGAAAAAGAGAAAGACTATGATAAAATTAATAACTTCATG
AAGCAAGAGTTGTCAAGATTAGAAGTATTCAAGGTTGCTTCAGTTCTTCAAATTTTACTT
TCAAGATATGGTCATCAAATAGAGCAAGTTAGAGAAACTATTATGCTGTTACTTTCTAAA
ATATCTATTCAATATCCTGGCTAATGTGCCTGGTGGATATTCCACTTTTTGTATTTTGAT
TAAGAAAGTGGTAACACAGCTAATGCAGCAGCAGCAAGAAGATAGTAAATTAATCAGAAA
CACTAAGCAATAACTCGAGCCGATTTTGCCAAGACTTTACTAGGTAAAATTATGGGATTA
GATCAAGCAGCTTATAAAAAGATTGTTGAAGGTGAAAAAGTATTCTTAGAGCTCAAGAAA
CTATCAGAAAAACCACCCACTTAGTAGAGTCAAGTGATTATGGAGCTTCCATAGTTCTTG
TAAAAGATCTCAACTTGCACTTTAACTACTTGTCCAATTAAATCTTTAAATAGAAGAAAC
TCAGCAATTCACAATCATTATTCAAATTTTGAACAACAAGCTTTAGAGGAAGAAGAGGCA
GCAAAGAATGGAATTGGAAGTTTATAGGATTTCCCAGCTTATAAGCCCAAACCAGTTATG
ATATCTGGGTTCTTAAATGAAGCAACTCTCATGTAATCAAAAGAAAAGCCAAAGAAAATT
GGTATAATTGGTTCAAATAAATAAGTCTACAACTTCTTACTCAAGTGTGACAAATTTGGC
GATTTAAGAAAGGAGCAAAGATTTATTGAATTTGCTTAACTATGCAACAAAATGCTTGAA
AATGATTCTGAAAGTAGAAAGAGAAACTTAAAACTGAGAACAAATGCAATAGTACCCCTT
AGCAGAAATAGTGGTCTTATCGAGTGGATTTAGAATACCTCAACTTTGAAATCTGTTGTT
GGAGATTATTGGAAGAAAAATAACATTAAGGGCGAAATGAATGAGATTAAGAATAAAGCT
ACTGCAATGAAAAACGGAGATACTCATACATTAATTTGGAATGCTGTCAAAGAAGATATC
AAACCAGTATTAGGTTCTTGGATGATAGACCACTTCCCAAATCCAGAGATCTGGTATGAA
GCAAGAATTAACTTCGTGAGATCAACTGCAATTTGGTCTATGATTGGGTATGTAATTGGA
CTTGGAGATCGCCATGGAGACAACATTTTGATACATCATCATACTGGTGAAGTGACACAT
GTAGATTTTGATTGTATCTTTGAGAAAGGAGCAAAGCTTAAAATCCCTGAAATTGTACCT
TTTAGATTAACTCAGAACATTATGGATGCTTTTGGAATCTTCAAAGAGAAAGGTATCTTC
TAGAGAACTTGCGAGGTAGTCCAAAGAGTGCTAAGAAAGAATTCCAAAAATATCATTTCC
TTCTTGGAATCCTTCATTCATGATCCACTTATTGAAAGCACCCAAAATATCAAAGTAGAA
ATCAAACAAGCTCTCGATGTTGTTAAGCAAAAGTTACATGGCCAAATTAAAGGCGATCAA
GGAGGCAGTGTAAACATTGAAGAACAAGTAGAGTTCGTAATTTTATAAGCTATAAACGAT
GAATCACTAGCTAAGATGTACATCGGATGGATGCCTTGGTTATGA


>Contig19156.0.g85(protein)
MESKKNSEFSVHQDMVMQELIYYKEELDIFGLNNENPTFDIQRYVDLKTFILMLSRNKRS
VDMVEHLLAAIFVVSDADGLTDKNKLLDCIVQKFKLFELLSKVIRVTPQELLRCASSHIC
GKITFLLMLHGSTISVIDKFIGVQFYNHFILPKSWYYLISVHKLTYEKLKETILSTQFNS
NTILISAIRDQLMHCIGKIALQHNLQSSQKKNLLQIMKNAFGFQNDQDMISFINGENGKG
LYYETQLLQILMKKLSFGRRFQLEKLMIKGDQDKTLVFYDKKQYMQTDFYNKKGESVKKK
IAQFKSALEFISKEFKKTNVTNSDFVIGFLEMFKIQFPTSLTDAKDSMTRQNKLIQYIMT
VELLIKEQLVEDPYFRTAIIVMTIFVLKIGIEYQDTVEIAIFSMQLILNAIGLQQALPYL
NKFCSLAVQAFIKFPEKLKIKKYTQKIINFYIKDKMKFTQAYFKDLQYLFLSKIKENEGF
KEAINLISYELYKTPEDIAENLKNLVNQLQTGNEDIRLLNTTYILELLEQQEQDEVRKVL
VLPENLKIVYQGILEMPQEYKTEKSRKLSLLCAKVVAAIGLCQPFVNDPLTLKATNQMTL
IGRKKEFEVQNTSDEQNPSIIKSDYYNPLTNLKYKNQEQDNTLEYLAVPSLSELPIERKD
IIKFAGQLLNQIQYISNITDLKPQQFYYTIFLIDKFINHHKMQQGLVEPNERDQLEQTIS
KQEHFAKTVFKFIGKDLTPVTEIDDPNSLSKKNYIKNLSLYLIHKIQDDTWKQLFIACIP
ALKISHKVLDLLLPYLIYYSLRFNQQDLSLPEDIGRLFNKIYDSNFSSQIAPTLKVQDFL
KICLNQDKKIFKTFIENDTKFKYVEKLFHIEFDSSKIKDQNVLNFIKVIEGNIHVKLSFL
AVKKIKALMCMIDKLKKINAAKTVKAYQRCIYSFEDHYRSQINQAGNQGKGFLDVLSHEE
TYDIINLNKQLNPEDYDYGIFNNIIESYNNNQEKHHNEESPMEVESNFIDLEAQRNKLIA
QKIKKLFSNPLIINDWHNNDWEKLEVWASDVDLGELNHKIIMIDTEQGDPLQKFEMIICL
FAAEYSKCLRSLLQNDDNLENPDYLSSLDKISKFFELLYCEFILTLDGIQGEISYYYKLF
LHVIYELESAVHYIKDVFLQEKDKIQEILRKEVNREKRRFEKIYYEFDMNNYFEKLLSWF
EERSMMIQNSTQSLKLIYYCRRMIFKLFDRENEYAFYLMKLAKIQRKTSNDILLISKLFK
ECESMQHRIVDYDLEYAKYMLKTKNAHEAYQYLIQKQDQIQKKCDEMYKTTKFQWMPQRV
ADKATLLSIELQIKIDPQNHNIQKRFDDFLKSIGKNQWEKPVFRFAQYLDELDLKNNSLQ
NPPSLDPTDARKRWIQKIFYYVNSLKYGYKYIWQSFPRALELWFEYNEKEKDYDKINNFM
KQELSRLEVFKVASVLQILLSRYGHQIEQVRETIMLLLSKISIQYPGQCAWWIFHFLYFD
QESGNTANAAAARRQQINQKHQAITRADFAKTLLGKIMGLDQAAYKKIVEGEKVFLELKK
LSEKPPTQQSQVIMELPQFLQKISTCTLTTCPIKSLNRRNSAIHNHYSNFEQQALEEEEA
AKNGIGSLQDFPAYKPKPVMISGFLNEATLMQSKEKPKKIGIIGSNKQVYNFLLKCDKFG
DLRKEQRFIEFAQLCNKMLENDSESRKRNLKLRTNAIVPLSRNSGLIEWIQNTSTLKSVV
GDYWKKNNIKGEMNEIKNKATAMKNGDTHTLIWNAVKEDIKPVLGSWMIDHFPNPEIWYE
ARINFVRSTAIWSMIGYVIGLGDRHGDNILIHHHTGEVTHVDFDCIFEKGAKLKIPEIVP
FRLTQNIMDAFGIFKEKGIFQRTCEVVQRVLRKNSKNIISFLESFIHDPLIESTQNIKVE
IKQALDVVKQKLHGQIKGDQGGSVNIEEQVEFVILQAINDESLAKMYIGWMPWL