Identifiers and Description

Gene Model Identifier

Contig697.1.g77

Standard Name

ATE1

Aliases

Contig697_1_g77

Description

Arginine-tRNA-protein transferase, C terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04377 ) Arginine-tRNA-protein transferase, C terminus
  • ( pfam04376 ) Arginine-tRNA-protein transferase, N terminus
  • ( pfam04103 ) CD20-like family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003106603.999970367130025e-21Arginine-tRNA-protein transfer
ase, C terminus...
SGDYGL017W4.997543945741262e-17ATE1 SGDID:S000002985, Chr VII
from 459854-461365, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig697.1.g77(coding)
ATGGAAGGCTCTTAATCTAACTCACAATCCTAAAATAAAGTTAACCAATAATAGTAAAAC
TTCGATTCAGATTACTATGATGAGGAAGATTATCAAATGAGCGATACTCACTAATCTTAA
TAGACTTCAGCTCCATACCTCACTCAACTAAGAACTCTTGAACCCCCAAAGATCATTGAG
AATAAAACCTCAATTCTCCTCTCAAAAACTCATGACTCATCTAAGGGAGGCTCGGAATGT
TCTTACTGCTGTGGTTTTAGGGAAACTTATAGCGGCGAGAAGCTCGAAGGACTTAAGTCA
TATAAGCAGGGATTTTCAAGCATGAAGATGAGATATGACGACTTTGAGGAATTGCTGAAT
AAGGGGTATTCTAGAAGTGGCACTTACTTTTATTAAAGAAATTTCAAGAATTCTTGTTGC
GAAACCTTTTAATATCGTGTGGATGCCATGAAATTCAAGCCATCTGATTCTCAAAGAAAA
GCAGTTAGAAAATTTCACAAATATATCAATTACGGTTCTATACATGGTAAACCTCCAGCG
AAACAATAGTAGGAAGAACAAAAATAAAAACTAAATAAAAATCTTCAAAATGAAAAACTT
TAATCCCTTCAAGAGCCTGAAGAAGAAATAATTTAATCAATTCATAATTTCATCAAAGAT
ATTCATCTAGAATCATAATTATTGAATCAATAATAAATTGATAAATTACAATAGGTTAAG
ACTAACTATAACAAGAAAATTAAAAGTATATCGTCTAATGCTTTGCATATAATTAAGTTA
GGAAAAGAGTAGTATGATAAGATTCTTTATATAATTAACAGCAAGTTTGATGGTTAAAGT
ACAGGCGATTACTAAATTGTGAAAATAGAGAATGGTTTTATAAACTTCTATAAGAAACTT
GATAAAAATTTAGAGAAGAATCCCTCTTAAATAGATAAAAGTTCACTTCAAGAAGAATTC
AAAGTGCCAGTATAAAAACAAATAAAACCCCTAAAAACTAAACTTATTAAAGAATAAAAG
TAAAATATAAACGGTTAAAATTATTAAGAATAAAACTACAAACCATACCCCCCAAATCAC
TATAAACATTACTGTATAGAGTATGATACAACCAACGACCCCCCAGAAGATCACATTCCT
GTGCACAACTATACCATCGAGATTAAGCATGCTTTATATACAGAGGAATTTTTCGATCTC
TATTTTAAGTATGAGAAGGCGATCCACAAAAAAGATAGAGATCCAGATGGTTTAAAACGA
TTTTTGTGTAATTCTCCAATCTACTATCCAGTTAGAGACGCTCACATGGCTTTCACAGAG
AGTTAAATTGACTATAAAACTATAGACTAGCTGTTTAGACCTGAGAATATAGATCTAGGG
GTGTACCCTGGCTATGGATCTTATCACATGTATCATAGAATAGATGGGAAATTAGTGGCT
GTAAATGTAATAGATATACTAAATGAGGTATTCGTGAGTGCCTACTGTATTTATGATCCT
GACATGAGCTTTCTCAGGCTTGGGGTTGTGACTGCAATCAGAGAACTAGAATATTTCAGA
ATGATTAAGGAAAGGTATAATCCCAATTTGAAATGGTATCAATTAGGGGAGATGGTAATC
ACCTGCCCTAAAGTAAACTATAAACTTAATTATAAACCAGGATATGTCATTTGCCCTAGA
ACTAAGGAACTTGTACCAATAGAGAAATGTGTTGACACGATTAACATGATAGCAAAGATG
TCTATTGATGAGAAAATGCAATTACCTTATATTTAATTGGTGGAATACAGAGGAGAAGGT
CCCCTTGAAAATGAATTACTTCCAGCTATTTTTGGGAAGGTCTTGCTATCTTTTCCTTTT
GTTTATGAAAACACAAAGAAACTGAATATTTCAATGCTAAGCTAATCAGGATAGGAACTT
ATGAAAAATGCTCTATCTGAGATGCTGGTTCATGTGGGCATTAAACTATTCTCATAATTT
ATGTTTGAACTTAAATACCCACCAGAAGATCCAAACGAAAAAAAGAAAGAAGAAGAGAAG
CAGAATTCCTAGTCACACTAGGATTAACAAAAAGATCATTAAGAGAAGAATTAGAACTCA
GATTAAGAAATGTCAAGTAATAACAATGATGTTGAAGGTGGTCAATAATAATAGCAGTAG
TAATAAGATTAGGATATGAAGGACTTGAGTTAGGAAGTCGATGATATTTCATAAATAAAT
AATAGCAATAGAGATACTAGAGATACTATGTGA


>Contig697.1.g77(protein)
MEGSQSNSQSQNKVNQQQQNFDSDYYDEEDYQMSDTHQSQQTSAPYLTQLRTLEPPKIIE
NKTSILLSKTHDSSKGGSECSYCCGFRETYSGEKLEGLKSYKQGFSSMKMRYDDFEELLN
KGYSRSGTYFYQRNFKNSCCETFQYRVDAMKFKPSDSQRKAVRKFHKYINYGSIHGKPPA
KQQQEEQKQKLNKNLQNEKLQSLQEPEEEIIQSIHNFIKDIHLESQLLNQQQIDKLQQVK
TNYNKKIKSISSNALHIIKLGKEQYDKILYIINSKFDGQSTGDYQIVKIENGFINFYKKL
DKNLEKNPSQIDKSSLQEEFKVPVQKQIKPLKTKLIKEQKQNINGQNYQEQNYKPYPPNH
YKHYCIEYDTTNDPPEDHIPVHNYTIEIKHALYTEEFFDLYFKYEKAIHKKDRDPDGLKR
FLCNSPIYYPVRDAHMAFTESQIDYKTIDQLFRPENIDLGVYPGYGSYHMYHRIDGKLVA
VNVIDILNEVFVSAYCIYDPDMSFLRLGVVTAIRELEYFRMIKERYNPNLKWYQLGEMVI
TCPKVNYKLNYKPGYVICPRTKELVPIEKCVDTINMIAKMSIDEKMQLPYIQLVEYRGEG
PLENELLPAIFGKVLLSFPFVYENTKKLNISMLSQSGQELMKNALSEMLVHVGIKLFSQF
MFELKYPPEDPNEKKKEEEKQNSQSHQDQQKDHQEKNQNSDQEMSSNNNDVEGGQQQQQQ
QQDQDMKDLSQEVDDISQINNSNRDTRDTM